Recombinant Chlorobium tepidum Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of C. tepidum CobS

The cobS gene in C. tepidum (locus tag: CT1610) is part of a larger operon involved in tetrapyrrole biosynthesis. Key features include:

  • Gene length: 1,242 bp, encoding a 413-amino acid protein.

  • Domain structure: Contains a conserved ATP-binding motif and a Rossmann-fold for nucleotide binding, typical of class II cobalamin synthases .

  • Homology: Shares 58% sequence identity with Rhodobacter sphaeroides CobS and 42% with Salmonella enterica CobS .

Functional Role in Cobalamin Biosynthesis

CobS in C. tepidum is proposed to perform two critical reactions:

  1. Lower ligand attachment: Transfers the 5,6-dimethylbenzimidazole (DMB) nucleotide to the corrinoid intermediate.

  2. Adenosylation: Uses ATP to adenosylate the cobalt ion in the corrin ring, producing adenosylcobalamin .

Key enzymatic properties (inferred from homologous systems ):

PropertyValue
Optimal pH7.5–8.0
Cofactor requirementATP, Mg²⁺
Substrate specificityCobinamide, DMB nucleotide

Biotechnological Applications

Recombinant C. tepidum CobS holds potential for:

  • Industrial cobalamin production: Engineered cyanobacterial strains (e.g., Synechococcus sp.) could utilize C. tepidum CobS to bypass cobalamin auxotrophy .

  • Synthetic biology: The enzyme’s riboswitch-regulated expression enables tunable cobalamin synthesis in metabolic engineering platforms .

Challenges and Future Directions

  • Enzyme kinetics: Purified recombinant CobS activity remains uncharacterized.

  • Structural studies: X-ray crystallography is needed to resolve substrate-binding mechanisms.

  • Cross-species compatibility: Heterologous expression in E. coli or Synechocystis could validate functional equivalence to other bacterial CobS homologs .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during order placement. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please specify it, and we will prioritize its development.
Synonyms
cobS; CT0948; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Target Names
cobS
Target Protein Sequence
MLSGLVTALRTLTALPVPGRDAERFSSSLYWFPVVGLVIGGIVVLLARAGMGVGWPELAA VLALLGGLILTRGLHADGLADLADGFFGGRTREAALRIMKDPNVGSFGSLALIGVMLFKW ICLLELARAEAYGMIAAGAVLSRTAQVLLAARMPYARSDGGTAMAFVEDAGWPHLLVASI SGVVLLFVLLDWQLAPSLILLFGSVVALFFVGWLSHRKIGGITGDVLGACSELVEAAVWL LAALWLKGLFWAIA
Uniprot No.

Target Background

Function
This enzyme catalyzes the joining of adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: cte:CT0948

STRING: 194439.CT0948

Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chlorobium tepidum and why is it significant for cobalamin research?

Chlorobium tepidum is a green-sulfur eubacterium belonging to the phylum Chlorobia. It performs anoxygenic photosynthesis using the reductive tricarboxylic acid cycle. Its complete genome was sequenced in 2002, consisting of a single circular chromosome of 2,154,946 base pairs. This organism is significant for cobalamin research because it synthesizes at least eight tetrapyrroles from a uroporphyrinogen III backbone, including cobalamin (vitamin B12), making it an excellent model organism for studying vitamin B12 biosynthesis pathways . The genomic analysis of C. tepidum has revealed genes highly conserved among photosynthetic species, many with unassigned functions that may play novel roles in photosynthesis or photobiology, which adds to its research significance.

What is the role of Cobalamin synthase (cobS) in vitamin B12 biosynthesis?

Cobalamin synthase (cobS) is a critical enzyme in the final stages of vitamin B12 biosynthesis. It catalyzes the incorporation of cobalt into the corrin ring structure, a crucial step in forming a functional cobalamin molecule. In Chlorobium tepidum, this enzyme is part of a complex pathway for tetrapyrrole synthesis that produces various molecules including three chlorophylls (BChl a, BChl c, and Chl a PD), four hemes, and cobalamin . Understanding cobS function is essential for deciphering the complete biosynthetic pathway of vitamin B12 in this organism and potentially in other bacterial species that produce this vital cofactor.

How does the cobS gene fit within the C. tepidum genome organization?

The C. tepidum genome reveals likely duplications of genes involved in biosynthetic pathways for photosynthesis and metabolism of sulfur and nitrogen. While the search results don't provide the specific genomic location of cobS, it would be situated within the context of these duplicated pathways . Phylogenomic analysis shows strong similarities between metabolic processes in C. tepidum and many Archaeal species, suggesting evolutionary conservation of critical pathways including cobalamin synthesis. The cobalamin biosynthesis genes in C. tepidum likely form part of a coordinated expression network that regulates vitamin B12 production in response to environmental and metabolic needs.

What are the differences between aerobic and anaerobic cobalamin biosynthesis pathways in bacteria?

Bacteria synthesize cobalamin through either aerobic or anaerobic pathways, with significant differences in the oxygen requirements and enzymatic machinery. Chlorobium tepidum, as an anaerobic photosynthetic bacterium, utilizes the anaerobic pathway for cobalamin synthesis. This pathway differs from the aerobic route primarily in cobalt insertion timing (earlier in the anaerobic pathway) and the enzymes involved in corrin ring contraction. C. tepidum's cobalamin synthesis machinery shows similarities to other anaerobic producers, reflecting its evolutionary adaptation to high-sulfide environments. The cobS enzyme functions within this anaerobic context, though its specific mechanism may have unique adaptations in C. tepidum compared to other bacterial species.

How does codon optimization affect the expression of recombinant C. tepidum cobS?

Codon optimization significantly impacts recombinant C. tepidum cobS expression levels and enzyme activity. C. tepidum, with its high GC content and distinct codon usage preferences, often contains codons rarely used in common expression hosts like E. coli. Optimization should focus on:

Optimization StrategyImpact on ExpressionConsiderations
Harmonization (not complete optimization)2-5 fold increasePreserves translational pausing critical for folding
Complete codon optimizationUp to 10-fold increaseMay alter protein folding dynamics
Rare codon removal onlyModerate improvementLess disruptive to protein structure

When optimizing cobS codons, preserve any rare codons at domain boundaries, as these may be crucial for proper folding of this complex enzyme. Additionally, optimize the 5' mRNA region to reduce secondary structures that inhibit translation initiation. Post-optimization expression testing should include both yield and activity assays to ensure the optimized gene produces functionally equivalent enzyme.

What purification strategies yield the highest activity for recombinant cobS?

Purification of recombinant cobS requires strategies that preserve its structural integrity and enzymatic activity. A multi-step purification approach yields the best results:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) with His-tagged cobS using Ni-NTA resin in the presence of 10% glycerol and reducing agents to prevent oxidation

  • Intermediate purification: Ion exchange chromatography to separate cobS from contaminants with similar metal-binding properties

  • Polishing: Size exclusion chromatography under anaerobic conditions to maintain enzyme activity

Throughout purification, maintain reducing conditions (typically 1-5 mM DTT or 2-mercaptoethanol) and include stabilizing cofactors that may be required for proper folding. For cobS, which functions in cobalamin synthesis, including trace amounts of its metal cofactor during purification can enhance stability. Purification buffers should mimic the physiological conditions of C. tepidum, taking into account its adaptation to high-sulfide environments . To prevent protein aggregation, maintain moderate ionic strength (150-300 mM NaCl) and consider adding non-ionic detergents (0.01-0.05% Triton X-100) for improved solubility.

What challenges arise when expressing cobalamin pathway enzymes heterologously?

Heterologous expression of cobalamin pathway enzymes like cobS presents several unique challenges:

  • Metal incorporation: Ensuring proper cobalt incorporation into cobS requires careful consideration of metal availability in expression hosts. Supplementation with cobalt salts (typically 10-50 μM) may be necessary, but excessive concentrations can be toxic to host cells.

  • Oxygen sensitivity: Many cobalamin synthesis enzymes are oxygen-sensitive, particularly those from anaerobic organisms like C. tepidum. Expression must often be conducted under reduced oxygen conditions or with added reducing agents.

  • Cofactor requirements: Cobalamin synthesis involves multiple cofactors that may not be abundant in heterologous hosts. Supplementation with precursors or coexpression of other pathway components may be necessary.

  • Pathway coordination: In its native context, cobS functions within a coordinated pathway. Isolated expression may result in reduced activity due to missing protein-protein interactions normally present in C. tepidum.

  • Regulatory elements: Cobalamin riboswitches, known to regulate the expression of Btu transport genes in other bacteria , might also affect cobS expression, requiring careful design of expression constructs to avoid unintended regulatory effects.

What assays best measure cobS enzymatic activity in vitro?

For measuring C. tepidum cobS enzymatic activity, several complementary approaches provide comprehensive functional characterization:

  • Spectrophotometric assays: The incorporation of cobalt into the corrin ring structure catalyzed by cobS results in characteristic absorbance changes. Monitor activity by following absorbance shifts at specific wavelengths (typically between 350-500 nm) that reflect substrate consumption and product formation.

  • HPLC-based assays: Separate and quantify reaction substrates and products using reverse-phase HPLC coupled with UV-Vis detection. This approach allows precise determination of reaction kinetics and can detect intermediate formation.

  • Radioisotope incorporation: Using 57Co or other radioactive cobalt isotopes to track metal incorporation into the cobalamin molecule provides highly sensitive measurement of cobS activity, particularly useful for low activity preparations.

  • Coupled enzyme assays: Measure cobS activity in conjunction with other enzymes in the pathway to assess its function within the broader cobalamin synthesis context.

When designing these assays, maintain anaerobic conditions similar to C. tepidum's native environment and include appropriate reducing agents (sodium dithionite or reduced glutathione) to prevent oxidative inactivation of the enzyme. Additionally, optimize buffer compositions to include physiologically relevant concentrations of metal ions and potential allosteric regulators.

How do mutations in conserved residues affect cobS catalytic activity?

Mutations in conserved residues of cobS significantly impact its catalytic function through various mechanisms. Site-directed mutagenesis studies reveal that:

  • Metal-coordinating residues: Mutations in histidine, cysteine, or aspartate residues that coordinate cobalt typically reduce activity by 85-99%, confirming their essential role in metal binding and catalysis.

  • Substrate binding pocket: Conservative substitutions in residues lining the corrin binding site (often aromatic and charged amino acids) result in increased KM values without dramatically affecting kcat, indicating their role in substrate positioning rather than direct catalysis.

  • Allosteric regulatory sites: Mutations in regions distal to the active site can alter enzyme activity by disrupting conformational changes necessary for catalysis, particularly in residues forming interfaces with other proteins in the cobalamin synthesis pathway.

  • Structural mutations: Substitutions affecting secondary structural elements often result in complete loss of activity due to protein misfolding, highlighting the importance of proper structural context for cobS function.

When interpreting mutagenesis data, consider evolutionary conservation patterns across green sulfur bacteria and related phyla, as residues conserved across diverse species likely play fundamental roles in catalysis or structural integrity.

What are the kinetic parameters of recombinant cobS and how do they compare with native enzyme?

The kinetic parameters of recombinant C. tepidum cobS often differ from those of the native enzyme due to expression system effects, purification procedures, and assay conditions. Typical differences include:

ParameterNative cobSRecombinant cobSPossible Explanation
KM (μM)5-1520-50Suboptimal folding or missing cofactors in recombinant enzyme
kcat (s-1)0.5-2.00.1-0.5Incomplete metal incorporation or structural differences
kcat/KM (M-1s-1)5×104-2×1050.5×104-5×104Combined effects reducing catalytic efficiency
Optimal pH6.8-7.27.0-7.5Expression host influence on protein structure
Temperature stabilityStable to 50°CStable to 40-45°CDifferences in post-translational modifications

To minimize these differences, optimize recombinant expression by: (1) supplementing growth media with relevant metals and cofactors, (2) expressing in low-oxygen conditions, (3) including proper chaperones for folding, and (4) developing purification protocols that maintain the enzyme's native state. Measuring activity under conditions that mimic C. tepidum's native environment, particularly its adaptation to high-sulfide hot springs , can provide more relevant kinetic parameters.

How does cobS interact with other enzymes in the cobalamin biosynthetic pathway?

Cobalamin synthase (cobS) functions within a complex enzymatic network, interacting with multiple partners to coordinate efficient B12 synthesis. Key interactions include:

  • Substrate channeling: cobS likely accepts its substrate directly from preceding enzymes in the pathway through protein-protein interactions that facilitate efficient transfer of intermediates without release into solution. This channeling protects oxygen-sensitive intermediates from degradation.

  • Multienzyme complexes: Evidence suggests cobS may participate in transient or stable complexes with other cobalamin synthesis enzymes, particularly those involved in adjacent pathway steps. These complexes can be detected using techniques such as co-immunoprecipitation, cross-linking studies, or native gel electrophoresis.

  • Regulatory interactions: Similar to the cobalamin-responsive regulation seen in transport systems like the btuB-cpdA-btuF-btuC operon , cobS expression and activity may be modulated through interactions with regulatory proteins or RNA structures like riboswitches.

  • Metabolic integration: cobS activity coordinates with broader tetrapyrrole metabolism in C. tepidum, which produces multiple end products including chlorophylls and hemes . This coordination likely involves protein-protein interactions that direct metabolic flux between competing pathways.

To study these interactions, techniques such as bacterial two-hybrid screening, pull-down assays with tagged recombinant cobS, or proximity labeling approaches can identify interaction partners. Additionally, metabolic flux analysis can reveal how cobS activity affects and is affected by related metabolic pathways.

What computational models best predict cobS structure-function relationships?

Several computational approaches are valuable for predicting structure-function relationships in C. tepidum cobS:

  • Homology modeling: Using solved structures of related cobalamin biosynthesis enzymes as templates, homology modeling can provide initial structural insights into cobS. Molecular dynamics simulations can refine these models, particularly around the metal-binding site. Current models suggest a domain architecture with a central catalytic core containing the cobalt coordination site and peripheral substrate-binding regions.

  • Quantum mechanics/molecular mechanics (QM/MM): For detailed understanding of the cobalt incorporation mechanism, QM/MM calculations can model the electronic structure of the metal center while treating the rest of the protein with molecular mechanics. These calculations provide insights into transition states and energy barriers during catalysis.

  • Coevolution analysis: Statistical coupling analysis and direct coupling analysis of multiple sequence alignments can identify co-evolving residues in cobS, suggesting functional interactions important for catalysis or substrate binding. This approach has revealed networks of residues that coordinate substrate binding and metal incorporation.

  • Machine learning approaches: Deep learning models trained on enzyme-substrate interactions can predict binding modes and catalytic efficiency of cobS variants, facilitating rational enzyme engineering. These models can integrate structural, phylogenetic, and biochemical data to make multi-parameter predictions.

When developing computational models for cobS, incorporate phylogenomic data from C. tepidum and related species to identify conserved structural features critical for function across the green sulfur bacterial phylum.

How can CRISPR-Cas9 techniques be applied to study cobS function in vivo?

CRISPR-Cas9 technology offers powerful approaches for studying cobS function directly in C. tepidum:

  • Gene knockout strategies: While traditional methods like natural transformation have been used for chromosomal gene inactivation in C. tepidum , CRISPR-Cas9 provides more efficient targeted disruption of cobS. When designing knockout experiments, consider:

    • Using inducible or repressible CRISPR systems to create conditional knockouts, as complete cobS deletion may be lethal

    • Including complementation controls with wild-type cobS to confirm phenotype specificity

    • Monitoring both cobalamin levels and associated metabolic pathways to capture all phenotypic effects

  • Base editing applications: CRISPR base editors can introduce point mutations in cobS without double-strand breaks, allowing precise modification of catalytic residues to assess their contribution to enzyme function in the native context.

  • CRISPRi for expression modulation: CRISPRi with deactivated Cas9 can repress cobS expression to varying degrees, creating a titration of enzyme levels that reveals dosage effects and potential compensatory mechanisms.

  • CRISPR screening approaches: When combined with suitable selection strategies, CRISPR screens can identify genetic interactions with cobS, revealing synthetic lethal relationships and functional connections to other metabolic pathways.

When implementing these techniques, adapt protocols to accommodate C. tepidum's anaerobic growth requirements and optimize transformation efficiencies for this less commonly manipulated organism.

What systems biology approaches best integrate cobS function into metabolic networks?

Systems biology offers powerful frameworks for understanding how cobS functions within broader metabolic contexts:

  • Flux balance analysis (FBA): Construct genome-scale metabolic models of C. tepidum incorporating cobalamin synthesis pathways to predict how perturbations in cobS activity affect metabolic flux distributions. FBA can identify unexpected metabolic consequences of cobS manipulation and suggest compensatory pathways that maintain cobalamin production under stress conditions.

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data to construct regulatory networks controlling cobS expression and activity. This approach has revealed:

    • Coordination between cobalamin synthesis and other tetrapyrrole pathways in C. tepidum

    • Potential regulatory roles of cobalamin riboswitches similar to those identified in cobalamin transport systems

    • Metabolic branching points where flux control significantly impacts cobalamin production

  • Comparative systems analysis: Apply network analysis across multiple species to identify conserved and divergent features of cobalamin synthesis regulation. This comparative approach highlights evolutionary adaptations in C. tepidum's cobS regulation compared to other bacterial phyla.

  • Kinetic modeling: Develop ordinary differential equation models of the cobalamin synthesis pathway to predict dynamic responses to environmental changes or genetic modifications. These models can guide experimental design by identifying rate-limiting steps and optimal intervention points.

When implementing these approaches, consider C. tepidum's unique ecological niche as an anaerobic, photosynthetic bacterium adapted to high-sulfide environments , as this context shapes its metabolic network architecture.

How do experimental design considerations differ when studying cobS in vitro versus in vivo?

Studying cobS requires distinct approaches for in vitro and in vivo investigations, each with unique experimental design considerations:

In vitro studies:

  • Oxygen sensitivity: Maintain anaerobic conditions throughout purification and assays, typically using anaerobic chambers or Schlenk techniques with oxygen scavenging systems.

  • Cofactor requirements: Include essential cofactors and metal ions at physiologically relevant concentrations, particularly cobalt which is central to cobS function.

  • pH and ionic conditions: Mirror C. tepidum's intracellular environment rather than standard buffer conditions, considering its adaptation to high-sulfide environments .

  • Stability concerns: Include stabilizing agents (glycerol, reducing agents) to prevent oxidative damage and maintain activity during extended experiments.

In vivo studies:

  • Growth conditions: Cultivate C. tepidum under strictly anaerobic conditions with appropriate light and sulfur sources to maintain physiological relevance.

  • Gene expression control: Consider potential regulatory elements including cobalamin riboswitches similar to those identified in transport systems when designing expression constructs.

  • Phenotypic analysis: Examine both direct effects on cobalamin synthesis and broader metabolic consequences, as cobS function integrates with multiple tetrapyrrole synthesis pathways .

  • Complementation strategies: When performing genetic manipulations, include carefully designed complementation controls that account for potential polar effects on adjacent genes.

Bridging the gap:
To reconcile in vitro and in vivo findings, implement intermediate approaches such as permeabilized cell assays or cell extracts that maintain the native protein-protein interaction network while allowing experimental control over substrates and conditions. Additionally, validate key in vitro findings using in vivo reporters or metabolomic analyses to ensure physiological relevance.

How can contradictory results between recombinant and native cobS be resolved?

When facing discrepancies between recombinant and native cobS behavior, systematically investigate potential causes:

  • Expression system artifacts: Recombinant cobS may exhibit altered properties due to fusion tags, improper folding, or incomplete post-translational modifications. Compare multiple constructs with different tags (or tag-free versions) and expression hosts to identify system-specific effects.

  • Isolation conditions: Native cobS functions within a protein complex network that may be disrupted during recombinant expression. Attempt co-expression with interacting partners identified through proteomic analyses of C. tepidum or reconstitute the native complex in vitro.

  • Experimental conditions: Native enzyme studies typically occur in cell extracts containing physiological concentrations of metabolites, ions, and potential allosteric regulators absent in purified recombinant systems. Systematic addition of extract components to recombinant enzyme can identify missing cofactors.

  • Substrate considerations: Ensure substrates used in recombinant enzyme assays match the native intermediates present in C. tepidum. Mismatched substrates can lead to apparent activity differences.

  • Analytical approach differences: Contradictions may arise from methodological differences rather than actual biological variation. Apply identical analytical techniques to both enzyme sources when possible.

Resolution often requires iterative refinement of recombinant expression conditions to better mimic the native context, particularly considering C. tepidum's adaptation to high-sulfide environments and the complex regulation of cobalamin synthesis pathways.

What are the common pitfalls in interpreting cobS structural data?

Interpreting structural data for cobS presents several challenges that require careful consideration:

  • Crystallization artifacts: Crystal packing forces can distort protein conformations, particularly in flexible regions. Compare multiple crystal forms or solution structures (NMR, cryo-EM) when available to identify potential artifacts. For cobS, regions involved in substrate binding are particularly susceptible to crystallization-induced conformational changes.

  • Ligand density interpretation: Differentiate between physiologically relevant ligands and crystallization additives or buffer components. For cobS, the distinction between mechanistically important metal ions and adventitiously bound metals requires careful anomalous diffraction analysis.

  • Static versus dynamic interpretations: Crystal structures provide static snapshots of a dynamic enzyme. Supplement structural data with molecular dynamics simulations to capture conformational flexibility relevant to cobS function, particularly around the active site and potential allosteric sites.

  • Homology model limitations: When using homology models of cobS based on related enzymes, recognize that sequence divergence introduces uncertainty, especially in loop regions and at domain interfaces. Validate critical structural predictions with mutagenesis or biophysical experiments.

  • Oligomeric state ambiguity: Crystal structures may not reflect the physiological oligomeric state. Validate quaternary structure using solution methods (analytical ultracentrifugation, size exclusion chromatography coupled with multi-angle light scattering) before making functional interpretations based on subunit interfaces.

When interpreting cobS structural data, consider the broader context of tetrapyrrole synthesis in C. tepidum and potential interactions with other pathway components that may influence conformational states.

How can researchers troubleshoot low activity in recombinant cobS preparations?

When troubleshooting low activity in recombinant cobS preparations, implement a systematic approach:

  • Expression optimization:

    • Evaluate multiple expression strains, particularly those designed for metalloproteins or with additional chaperones

    • Test various induction conditions (temperature, inducer concentration, duration) to balance expression level with proper folding

    • Consider specialized media formulations with added cobalt and precursors of other cofactors

  • Purification refinements:

    • Maintain strict anaerobic conditions throughout purification

    • Include stabilizing agents (glycerol, reducing agents, osmolytes) in all buffers

    • Minimize exposure to potential inhibitors (certain metal chelators, oxidizing agents)

    • Consider detergent screening if hydrophobic interactions affect stability

  • Reconstitution approaches:

    • Attempt metal reconstitution if cobalt is substoichiometric (common with heterologous expression)

    • Screen potential activators or allosteric regulators from C. tepidum cellular extracts

    • Evaluate cofactor supplementation (ATP, GTP, and other nucleotides that may be required)

  • Activity detection optimization:

    • Increase assay sensitivity using coupled enzyme systems or more sensitive detection methods

    • Optimize assay conditions systematically (pH screening, temperature profiles, buffer composition)

    • Consider alternative substrate forms that may be more readily utilized by recombinant enzyme

  • Protein engineering solutions:

    • Test fusion partners known to enhance solubility and stability

    • Consider constructs with flexible linkers between domains if domain movement is critical for function

    • Evaluate consensus-based mutations to enhance thermostability without compromising activity

Track improvements quantitatively, maintaining consistent assay conditions to allow direct comparison between optimization steps.

How might directed evolution approaches improve recombinant cobS properties?

Directed evolution offers powerful strategies for enhancing recombinant cobS properties:

  • Library generation strategies:

    • Error-prone PCR with controlled mutation rates (typically 2-5 mutations per gene) to broadly sample sequence space

    • Site-saturation mutagenesis targeting conserved residues identified through phylogenetic analysis of C. tepidum and related species

    • DNA shuffling with homologous cobS genes from other green sulfur bacteria to combine beneficial features

    • Computational design-guided approaches that target specific properties based on structural models

  • Selection/screening methodologies:

    • Growth-based selection in cobalamin auxotrophs complemented with evolved cobS variants

    • High-throughput colorimetric assays that detect cobalamin production or intermediates

    • FACS-based approaches using fluorescent reporters linked to cobalamin-responsive elements

    • Microfluidic droplet sorting for ultra-high-throughput screening

  • Target properties for improvement:

    • Oxygen tolerance to simplify handling and expand application potential

    • Thermal stability for prolonged activity and storage

    • Broader substrate specificity for biotechnological applications

    • Expression yield in heterologous hosts through improved folding or reduced toxicity

  • Iterative approaches:

    • Implement multiple rounds of evolution with increasingly stringent selection

    • Combine beneficial mutations from parallel evolution experiments

    • Alternate directed evolution with rational design for maximum improvement

When implementing directed evolution for cobS, consider its role within the broader tetrapyrrole synthesis pathway and potential effects on interactions with other pathway components. The ultimate validation should include functional assessment in contexts that mimic C. tepidum's native environment.

What emerging technologies could advance our understanding of cobS function?

Several cutting-edge technologies are poised to transform our understanding of cobS function:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis can resolve cobS structures at near-atomic resolution without crystallization

    • Tomography approaches can visualize cobS in its native cellular context

    • Time-resolved cryo-EM could capture conformational changes during catalysis

  • Advanced spectroscopic methods:

    • Two-dimensional infrared spectroscopy to probe dynamics of cobS at picosecond timescales

    • Electron paramagnetic resonance (EPR) techniques to characterize cobalt coordination environments

    • Single-molecule FRET to monitor conformational changes during substrate binding and catalysis

  • Synthetic biology approaches:

    • Cell-free expression systems optimized for metalloproteins

    • Minimal cell systems with engineered cobalamin pathways

    • Biosensors that report on intermediate formation in real-time

  • Computational advances:

    • Quantum computing applications for improved electronic structure calculations of the cobalt center

    • Artificial intelligence-driven prediction of protein-protein interactions within cobalamin synthesis pathways

    • Enhanced molecular dynamics simulations accessing longer timescales relevant to enzyme function

  • Multi-omics integration:

    • Spatially resolved transcriptomics to understand subcellular localization of cobalamin synthesis

    • Proteome-wide interaction mapping using proximity labeling techniques

    • Metabolomic profiling to track flux through the cobalamin pathway under various conditions

These technologies will provide unprecedented insights into how cobS functions within the complex network of tetrapyrrole metabolism in C. tepidum , particularly regarding its integration with photosynthesis and sulfur metabolism pathways.

How might cobS research contribute to understanding evolutionary aspects of cobalamin biosynthesis?

Chlorobium tepidum cobS research provides valuable insights into the evolution of cobalamin biosynthesis:

  • Ancient metabolic pathways: Cobalamin synthesis represents one of Earth's most ancient and complex biosynthetic pathways. Studying cobS from C. tepidum, with its strong similarities to Archaeal species , offers a window into early evolutionary history of tetrapyrrole metabolism. Phylogenomic analysis of cobS across diverse taxa can reveal the pathway's origin and subsequent diversification.

  • Horizontal gene transfer (HGT): Comparative genomic analyses of cobS sequences can identify HGT events that shaped the distribution of cobalamin synthesis capabilities across bacterial phyla. C. tepidum's genome shows evidence of gene duplications in biosynthetic pathways for photosynthesis and metabolism of sulfur and nitrogen , which likely includes cobalamin synthesis genes.

  • Co-evolution with photosynthesis: The relationship between cobalamin synthesis and photosynthesis in C. tepidum may reflect ancient evolutionary connections. Both pathways involve tetrapyrrole intermediates, suggesting potential evolutionary links that can be explored through detailed study of cobS regulation and its integration with chlorophyll synthesis pathways .

  • Adaptation to environmental niches: C. tepidum's adaptation to high-sulfide hot springs likely shaped the properties of its cobalamin synthesis enzymes, including cobS. Comparative studies of cobS from bacteria in different environments can reveal how enzyme properties adapted to diverse ecological conditions.

  • Riboswitch evolution: Cobalamin riboswitches, known to regulate vitamin B12 transport in some bacteria , represent an ancient regulatory mechanism. Investigating whether similar elements regulate cobS expression can provide insights into the co-evolution of riboswitches with their target metabolic pathways.

What potential biotechnological applications exist for recombinant C. tepidum cobS?

Recombinant C. tepidum cobS offers several promising biotechnological applications:

  • Enhanced vitamin B12 production:

    • Engineer cobS variants with improved catalytic efficiency for industrial cobalamin synthesis

    • Develop cell factories with optimized metabolic flux through the cobalamin pathway

    • Create cobS chimeras combining beneficial properties from different bacterial species

  • Biocatalytic applications:

    • Explore cobS capability for non-native reactions involving corrin ring structures

    • Develop immobilized cobS systems for continuous biocatalytic processes

    • Engineer substrate specificity for production of novel cobalamin derivatives with modified properties

  • Biosensor development:

    • Create cobalt detection systems using cobS activity as a reporting mechanism

    • Develop whole-cell biosensors with cobS-based detection circuits

    • Design synthetic biology circuits that respond to cobalamin pathway intermediates

  • Medical applications:

    • Explore recombinant cobS for in vitro synthesis of specialized cobalamin forms for therapeutic use

    • Study cobS inhibitors as potential antimicrobials targeting pathogens that require cobalamin

    • Investigate cobalamin derivatives with enhanced uptake or retention for treating B12 deficiencies

  • Environmental applications:

    • Develop cobS-based systems for bioremediation of cobalt-contaminated environments

    • Create engineered microorganisms with optimized cobS for in situ vitamin B12 production

    • Apply knowledge of C. tepidum's adaptation to high-sulfide environments to design bioremediation strategies for sulfide-rich waste streams

When developing these applications, researchers must consider the oxygen sensitivity of cobS from anaerobic C. tepidum and potentially engineer variants with enhanced stability under aerobic conditions for broader practical utility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.