Recombinant Chlorobium tepidum Cytochrome b6-f complex iron-sulfur subunit (petC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petC; CT0302; Cytochrome b6-f complex iron-sulfur subunit; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; Rieske iron-sulfur protein; ISP; RISP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-181
Protein Length
Full Length of Mature Protein
Species
Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Target Names
petC
Target Protein Sequence
AQTGNFKSPARMSSLGQGAAPASAGAVTGGKPREEGLKGVDFERRGFLQKIVGGVGAVVA VSTLYPVVRYIVPPAKKIKIVNELAVGPASDVPNGTGKIYQFNDDKVIVVNHGGSLTAVS AICTHLGCLVHWDEAADMIACPCHGAKYTQDGKIISGPQPLPLKQYKVKIEDGKIVVSIA
Uniprot No.

Target Background

Function

This protein is a component of the green sulfur bacterium Chlorobium tepidum's bc-complex. This complex, comprising the Rieske protein and cytochrome b subunit, lacks a cytochrome c1 equivalent and exhibits a relatively low redox potential.

Database Links

KEGG: cte:CT0302

STRING: 194439.CT0302

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chlorobium tepidum and why is it important for studying cytochrome complexes?

Chlorobium tepidum is an anaerobic, thermophilic green sulfur bacterium first isolated from New Zealand. Its cells are gram-negative, non-motile rods of variable length that contain chlorosomes and bacteriochlorophyll a and c . It serves as a model system for studying phototrophic sulfur oxidation and anoxygenic photosynthesis . C. tepidum is particularly valuable for studying cytochrome complexes because:

  • It is naturally transformable and performs homologous recombination, enabling precise genetic manipulation .

  • Its genome has been completely sequenced, facilitating comparative genomic analyses .

  • It grows photoautotrophically under defined conditions, making it ideal for controlled experiments .

  • Its photosynthetic electron transport chain represents a distinct evolutionary lineage, providing insights into the diversity of cytochrome complex structures.

What role does the petC gene product play in Chlorobium tepidum metabolism?

The petC gene in C. tepidum encodes the iron-sulfur subunit of the cytochrome b6-f complex, which serves as a critical component in photosynthetic electron transport. This protein:

  • Contains a Rieske-type iron-sulfur cluster that participates in electron transfer reactions.

  • Functions in the electron transport chain between photosystem I and terminal electron acceptors.

  • Contributes to generating the proton gradient necessary for ATP synthesis.

  • Plays a role in the organism's unique sulfur oxidation pathways, particularly in regulating electron flow during changes in sulfur availability .

The iron-sulfur subunit is particularly important in C. tepidum because the organism relies on sulfur compounds rather than H2 or Fe2+ as electron donors, differentiating it from other green sulfur bacteria .

What are the optimal expression systems for producing recombinant C. tepidum petC protein?

The optimal expression system for recombinant C. tepidum petC depends on research objectives and downstream applications. Based on established protocols for similar iron-sulfur proteins:

Bacterial Expression Systems:

Methodological Considerations:

  • Co-express with chaperone proteins to facilitate proper folding of the iron-sulfur cluster.

  • Supplement growth media with iron ammonium citrate (0.1-0.5 mM) and sodium sulfide (0.1-0.5 mM) to enhance cluster assembly.

  • Perform cultivation under microaerobic conditions (1-5% O2) to protect the iron-sulfur clusters from oxidative damage.

  • Include reducing agents (2-5 mM DTT or β-mercaptoethanol) in all buffers during purification.

For studies requiring native-like function, consider homologous expression in C. tepidum itself, though this requires specialized anaerobic cultivation equipment and results in lower yields .

What purification strategy yields the highest activity for recombinant petC protein?

A multi-step purification strategy is recommended to maintain the structural integrity and electron transfer activity of the recombinant petC protein:

Recommended Purification Protocol:

  • Initial clarification: Perform cell lysis under anaerobic conditions with 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 5 mM DTT, and protease inhibitor cocktail.

  • Affinity chromatography: Use His-tag purification with imidazole gradient elution (20-250 mM) under gentle conditions.

  • Size exclusion chromatography: Apply to Superdex 75 or 200 columns to separate monomeric from aggregated forms.

  • Ion exchange chromatography: Further purify using anion exchange (e.g., Q-Sepharose) with pH 7.5-8.0 to remove co-purifying proteins.

Critical Parameters for Maintaining Activity:

  • Perform all steps at 4°C in an anaerobic chamber or with degassed buffers.

  • Include stabilizing agents: 10% glycerol, 1 mM DTT, and 0.1-0.5 mM ferrous ammonium sulfate.

  • Monitor iron-sulfur cluster integrity by UV-visible spectroscopy during purification (characteristic absorbance peaks at ~330 nm and ~420 nm).

  • Avoid freeze-thaw cycles; store purified protein at -80°C in single-use aliquots with 20% glycerol.

This strategy typically yields protein with >90% purity and preserved iron-sulfur cluster incorporation, essential for functional studies.

How can the integrity of the iron-sulfur cluster in recombinant petC be verified?

Verifying the integrity of the iron-sulfur cluster requires multiple complementary analytical techniques:

Spectroscopic Methods:

  • UV-visible spectroscopy: Intact Rieske-type [2Fe-2S] clusters show characteristic absorption peaks at approximately 330 nm and 420 nm.

  • Electron Paramagnetic Resonance (EPR): The reduced form of the [2Fe-2S] cluster exhibits a distinctive g-value signature (typically g = 1.89, 1.95, and 2.02).

  • Circular Dichroism (CD): Provides information about both protein secondary structure and iron-sulfur cluster integrity.

  • Mössbauer spectroscopy: Offers detailed information about the oxidation state and chemical environment of iron atoms.

Biochemical Assays:

  • Iron and sulfur content determination: Use colorimetric assays (e.g., ferrozine for iron, methylene blue for acid-labile sulfur) to quantify the ratio of Fe:S, with expected 1:1 ratio for properly formed [2Fe-2S] clusters.

  • Enzymatic activity assays: Measure electron transfer rates using artificial electron donors and acceptors (e.g., reduced decylubiquinone as donor and ferricyanide as acceptor).

Protein Stability Assessment:

  • Differential scanning calorimetry (DSC) to determine thermal stability.

  • Limited proteolysis to assess structural integrity.

Each technique provides complementary information, and the combined data offer comprehensive verification of proper iron-sulfur cluster assembly.

What are the established protocols for measuring electron transfer activity in recombinant petC?

Measuring electron transfer activity of recombinant petC requires specialized techniques that mimic its native function in the photosynthetic electron transport chain:

In vitro Electron Transfer Assays:

  • Cytochrome c reduction assay: Monitor the reduction of cytochrome c at 550 nm in the presence of reduced plastoquinone analogs.

  • Ferricyanide reduction assay: Measure the decrease in absorbance at 420 nm as ferricyanide is reduced.

  • DCIP (2,6-dichlorophenolindophenol) reduction: Monitor the decrease in absorbance at 600 nm.

Standard Reaction Conditions:

  • Buffer: 50 mM MOPS (pH 7.0), 100 mM NaCl

  • Temperature: 25°C for standard assays, 46°C for native-like conditions

  • Anaerobic environment to prevent oxidation

  • Electron donors: reduced decylubiquinone (50-100 μM)

  • Electron acceptors: cytochrome c (50 μM) or ferricyanide (1 mM)

Data Analysis Approaches:

  • Calculate initial rates from the linear portion of progress curves

  • Determine kinetic parameters (kcat, Km) using Michaelis-Menten analysis

  • Compare activity under varying conditions (pH, temperature, salt concentration)

Quality Control Criteria:

  • Specific activity should be >1 μmol cytochrome c reduced/min/mg protein

  • Activity should be inhibited by known inhibitors (antimycin A, DBMIB)

  • Activity should be lost upon iron chelation or oxidative damage

How does the C. tepidum petC gene expression change in response to environmental sulfur availability?

The expression of petC in C. tepidum demonstrates sophisticated regulation in response to changing sulfur sources, reflecting the organism's adaptation to variable environmental conditions:

Transcriptional Response Patterns:
RNA sequencing (RNA-seq) studies have revealed that C. tepidum modifies expression of approximately 7% of its protein-coding genes following changes in sulfur availability . While petC-specific data is limited in the search results, related observations about sulfur metabolism genes suggest:

  • Genes involved in electron transport chains show differential expression when electron donor availability changes.

  • Rapid shifts occur in gene expression following sulfide addition to thiosulfate-grown cultures .

  • Expression patterns likely reflect the preferential utilization hierarchy of sulfur compounds (sulfide > elemental sulfur > thiosulfate) .

Proposed Regulatory Mechanisms:

  • Transcriptional regulation by sulfide-responsive regulatory proteins, potentially including the DNA-binding domain protein encoded by CT1277, which shows strong increases in expression following sulfide addition .

  • Possible involvement of the DtxR homolog (CT1737) that shows elevated expression in response to sulfide .

  • Redox-based regulation systems that respond to changes in cellular redox status when switching between different electron donors.

Research Methodology for Studying petC Regulation:

  • Quantitative RT-PCR to measure petC transcript levels under different sulfur availability conditions.

  • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the petC promoter region.

  • Reporter gene assays using the petC promoter fused to fluorescent proteins to visualize expression dynamics.

What structural adaptations distinguish the C. tepidum petC from those of oxygenic phototrophs?

The C. tepidum petC exhibits several structural adaptations that reflect its function in an anaerobic, sulfur-based photosynthetic system:

Key Structural Distinctions:

  • Oxygen tolerance mechanisms: Unlike oxygenic phototrophs, C. tepidum petC likely lacks extensive oxygen protection features since it operates in anaerobic environments .

  • Redox potential tuning: The protein environment around the [2Fe-2S] cluster is adapted for the specific redox potential requirements of anoxygenic photosynthesis.

  • Interface adaptations: Has evolved specialized interfaces for interaction with the unique quinone species used in green sulfur bacterial electron transport chains.

  • Stability adaptations: Contains thermostability features reflecting C. tepidum's thermophilic nature (optimal growth at 46°C) .

Comparative Structural Analysis Methods:

  • Homology modeling based on crystallographic data from related cytochrome b6-f complexes.

  • Hydrogen-deuterium exchange mass spectrometry to identify regions with different solvent accessibility.

  • Site-directed mutagenesis of conserved vs. divergent residues to determine functional significance.

  • Electrostatic surface potential mapping to visualize differences in charged surface patches.

These structural adaptations provide insight into how electron transport components have evolved to function in diverse photosynthetic systems.

What strategies are effective for generating site-directed mutations in the C. tepidum petC gene?

C. tepidum's natural competence and ability to perform homologous recombination make it amenable to genetic manipulation, enabling effective site-directed mutagenesis of the petC gene:

Recommended Approach for in vivo Mutagenesis:

  • Design of mutagenic constructs:

    • Create a construct containing the petC gene with desired mutation(s) flanked by >500 bp homologous sequences

    • Include a selectable marker (typically antibiotic resistance) adjacent to the mutated gene

    • Optimize codon usage according to C. tepidum preferences

  • Transformation protocol:

    • Grow C. tepidum cultures at 46°C to mid-exponential phase

    • Concentrate cells and resuspend in fresh medium

    • Add 1-5 μg mutagenic DNA construct

    • Incubate under low light for 18-24 hours before plating on selective media

    • Culture plates at 46°C under appropriate light conditions with spectinomycin (300 μg/ml) and streptomycin (150 μg/ml) selection

  • Verification techniques:

    • PCR amplification and sequencing of the target region

    • Western blot analysis to confirm protein expression

    • Functional assays to assess the impact of the mutation

Alternative Approaches for Complex Mutations:

  • CRISPR-Cas9 systems adapted for anaerobic, thermophilic conditions

  • Recombineering using phage-derived recombination systems

  • Two-step selection/counterselection strategies using sacB or similar markers

The efficiency of transformation typically ranges from 10^-5 to 10^-7 transformants per viable cell, with homologous recombination being the primary mechanism for integration.

How can researchers distinguish between direct effects of petC mutations and pleiotropic consequences?

Distinguishing direct effects from pleiotropic consequences of petC mutations requires a multi-faceted experimental approach:

Comprehensive Analysis Framework:

  • Comparative phenotypic characterization:

    • Growth rates under varying light intensities (8-700 μmol photons m^-2 s^-1)

    • Photosynthetic efficiency measurements (P/I curves)

    • Sulfur compound utilization patterns

    • Analysis under stress conditions (temperature, pH, oxidative stress)

  • Multi-omics approach:

    • Transcriptomics: RNA-seq to identify differentially expressed genes between wild-type and mutant strains

    • Proteomics: Quantitative analysis of protein levels, particularly components of photosynthetic complexes

    • Metabolomics: Analysis of key metabolites in sulfur oxidation and carbon fixation pathways

    • Fluxomics: Measurement of electron transport rates and metabolic fluxes

  • Complementation strategies:

    • In trans expression of wild-type petC in mutant background

    • Domain swapping to identify functional regions

    • Heterologous expression of related petC genes from other organisms

  • Control experiments:

    • Creation of silent mutations that don't alter protein sequence

    • Introduction of mutations in adjacent but functionally unrelated genes

    • Conditional expression systems to control timing of phenotype induction

Interpretation Guidelines:

  • Direct effects typically manifest immediately upon mutation and affect specific biochemical processes

  • Pleiotropic effects often emerge progressively and impact seemingly unrelated systems

  • Effects that can be rescued by complementation with wild-type petC alone are likely direct

This systematic approach helps differentiate between primary phenotypes directly resulting from altered petC function and secondary effects arising from disrupted cellular homeostasis.

How can structural knowledge of C. tepidum petC contribute to understanding evolutionary adaptations in photosynthetic electron transport?

The structural characterization of C. tepidum petC provides valuable insights into the evolution of photosynthetic electron transport systems:

Evolutionary Significance:

  • C. tepidum represents an ancient photosynthetic lineage that diverged before the evolution of oxygenic photosynthesis

  • Its cytochrome b6-f complex operates in an anaerobic, sulfur-based photosynthetic system rather than an oxygen-evolving one

  • Structural adaptations in petC reflect specialization for interactions with specific electron donors (sulfide, elemental sulfur, thiosulfate) rather than water

Comparative Evolutionary Analysis Approaches:

  • Phylogenetic reconstruction of petC sequences across diverse photosynthetic bacteria

  • Ancestral sequence reconstruction to infer properties of ancient photosynthetic electron transport components

  • Identification of conserved residues versus lineage-specific adaptations

  • Molecular clock analyses to date divergence events in petC evolution

Knowledge Integration Methods:

  • Structure-guided sequence analysis to identify functional domains under different selective pressures

  • Homology modeling of petC from diverse photosynthetic organisms

  • Molecular dynamics simulations to compare dynamics and electron transfer properties

  • Structural bioinformatics approaches to identify co-evolving networks of residues

Research Applications:
This evolutionary understanding can inform the design of artificial photosynthetic systems and contribute to our knowledge of how electron transport chains adapt to different environmental conditions throughout evolutionary history.

What are the cutting-edge methodologies for studying electron transfer kinetics in recombinant C. tepidum petC?

Recent advances have enabled increasingly sophisticated approaches to studying electron transfer kinetics in recombinant cytochrome systems:

State-of-the-Art Kinetic Analysis Techniques:

  • Ultra-fast spectroscopy:

    • Femtosecond transient absorption spectroscopy to capture electron transfer events

    • Time-resolved fluorescence spectroscopy to monitor energy transfer processes

    • Pump-probe spectroscopy to measure electron transfer rates between specific cofactors

  • Advanced electrochemical methods:

    • Protein film voltammetry on modified electrodes

    • Square wave voltammetry for higher sensitivity detection

    • Electrochemical impedance spectroscopy to characterize interfacial electron transfer

    • Scanning electrochemical microscopy for spatially resolved measurements

  • Single-molecule approaches:

    • Single-molecule fluorescence resonance energy transfer (smFRET)

    • Atomic force microscopy-based conductance measurements

    • Single-protein electrical measurements using nanogap electrodes

  • Computational methods:

    • Quantum mechanical/molecular mechanical (QM/MM) simulations

    • Machine learning approaches to predict electron transfer pathways

    • Brownian dynamics simulations of protein-protein interactions during electron transfer

Experimental Design Considerations:

  • Temperature control systems capable of maintaining the thermophilic conditions preferred by C. tepidum (46°C)

  • Anaerobic chambers or microfluidic devices to prevent oxidative damage

  • Reconstitution into liposomes or nanodiscs to mimic the native membrane environment

  • Integration with structural data (e.g., from cryo-EM or X-ray crystallography) for structure-function correlation

These advanced methodologies provide unprecedented insights into the fundamental mechanisms of electron transfer in photosynthetic systems and can reveal how C. tepidum has optimized its electron transport chain for its unique ecological niche.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.