Recombinant Chlorobium tepidum Cytochrome c (pscC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chlorobium tepidum Cytochrome c (pscC)

Chlorobium tepidum cytochrome c (pscC), also known as cytochrome c-551, is a vital component of the photosynthetic reaction center in green sulfur bacterium Chlorobaculum tepidum . This bacterium is a thermophilic anaerobic organism that uses reduced sulfur compounds as electron donors during anoxygenic photosynthesis . The pscC protein mediates the transfer of electrons from the menaquinol/cytochrome c oxidoreductase to P840, the primary electron donor in the reaction center .

Role in Electron Transfer

Cytochrome c-551 is crucial for electron transfer within the photosynthetic reaction center . In C. tepidum, multiple pathways exist for the reduction of the reaction center-bound cytochrome c-551 . A soluble monoheme cytochrome c-554 donates electrons to the bound cytochrome c-551 rather than directly to oxidized P840 .

Genetic and Evolutionary Aspects

The pscC protein is encoded by the gene CT1639 in C. tepidum . PscC exhibits structural and functional similarities to other cytochromes c found in various photosynthetic organisms, suggesting a conserved role in electron transport . The soluble domain of the heme-containing cytochrome subunit PscC and part of the core subunit PscA are located on the periplasmic side of the membrane . There is a close relationship between the periplasmic portions of PscA and PscC, which is needed for the efficient transfer of the electron between PscC and P840 .

Biotechnological and Research Applications

Recombinant Chlorobium tepidum cytochrome c (pscC) is used in various biochemical and biophysical studies . Recombinant pscC can be expressed and purified for in vitro studies of electron transfer mechanisms, protein-protein interactions, and structural analysis .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your reconstitution.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pscC; CT1639; Cytochrome c; Cytochrome c-z; Cyt c-z; Photosystem P840 reaction center cytochrome c-551
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Target Names
pscC
Target Protein Sequence
MDKNSNGKLIALAVGGAVLMGALFFSVSFLTGYIPAPNHSAILTPLRSFMGWFLLIFCAS IIIMGLGKMSSAISDKWFLSFPLSIFVIVMVMFLSLRVYWEKGRTTTVDGKYIRTTAELK EFLNKPAATSDVPPAPAGFDFDAAKKLVDVRCNKCHTLDSVADLFRTKYKKTGQVNLIVK RMQGFPGSGISDDDAKTIGIWLHEKF
Uniprot No.

Target Background

Function
Monoheme cytochrome serving as the immediate electron donor to P840 within the photosynthetic reaction center complex.
Database Links

KEGG: cte:CT1639

STRING: 194439.CT1639

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chlorobium tepidum Cytochrome c (PscC) and what is its function?

Chlorobium tepidum Cytochrome c (PscC) is a 23 kDa protein that forms part of the reaction center core (RCC) complex in the green sulfur bacterium Chlorobium tepidum (now also classified as Chlorobaculum tepidum) . PscC functions as an electron transfer mediator between the menaquinol/cytochrome c oxidoreductase and the primary electron donor P840 in the photosynthetic reaction center . The protein has a distinctive structure with three membrane-spanning regions at the N-terminal end and a soluble domain that binds a single heme group at the C-terminal end, positioned on the periplasmic side of the membrane . This structural arrangement enables PscC to efficiently transfer electrons across the membrane during photosynthesis, making it essential for the photosynthetic capabilities of C. tepidum .

How does PscC interact with other components of the reaction center complex?

PscC interacts closely with other subunits of the reaction center complex, particularly with the core subunit PscA. Both the periplasmic portions of PscA and PscC have a close spatial relationship that facilitates efficient electron transfer between PscC and P840 (a special pair of bacteriochlorophyll a molecules contained within PscA) . The reaction center complex consists of multiple subunits: the core PscA proteins (which form a homodimer), the iron-sulfur protein PscB, the cytochrome c PscC, and the PscD protein . Cross-linking studies have shown that all five subunits of the reaction center complex (including the Fenna-Matthews-Olson antenna protein) can be chemically linked, indicating their close association in the functional complex . This arrangement creates an electron transfer pathway from the cytochrome c to the reaction center special pair, which is critical for photosynthetic activity .

What techniques are available for expressing recombinant PscC?

Several techniques have been developed for expressing recombinant PscC in C. tepidum. One established method involves bacterial conjugation with Escherichia coli using RSF1010-derivative broad-host-range plasmids such as pDSK5191 and pDSK5192 . These plasmids confer erythromycin and streptomycin/spectinomycin resistance, respectively, allowing for selection of transformed cells . The expression plasmid can be constructed by incorporating the upstream and downstream regions of the pscAB gene cluster from the C. tepidum genome, as these regions contain a constitutive promoter and a ρ-independent terminator, respectively .

For protein production, a His-tagged version of the protein can be created using plasmids like pDSK5191-6xhis-pscAB, which has been shown to produce approximately four times more of the photosynthetic reaction center complex compared to expression from the genome using traditional natural transformation methods . The conjugative plasmid transfer is typically achieved at a frequency of approximately 10^-5 by selection with appropriate antibiotics, and the plasmids remain stable in C. tepidum cells when maintained under antibiotic selection .

What structural features of the PscC protein influence its electron transfer efficiency?

The electron transfer efficiency of PscC is influenced by several structural features, particularly its membrane topology and the spatial relationship between its heme-binding domain and the electron transfer partners. The close relationship between the periplasmic portions of PscA and PscC is critical for efficient electron transfer between PscC and the P840 special pair in PscA . The soluble C-terminal domain of PscC, which binds a single heme group, is positioned on the periplasmic side of the membrane, while the N-terminal portion contains three membrane-spanning regions .

Analysis of the soluble heme-containing domain of PscC through crystallographic studies has provided insights into the structure-function relationship of this protein . The precise arrangement of amino acid residues around the heme group affects the redox potential and electron transfer kinetics. Furthermore, the relative orientation and distance between the heme of PscC and the P840 special pair in PscA determine the rate and efficiency of electron transfer. Cross-linking studies combined with mass spectrometry have been instrumental in identifying the interaction sites between PscC and other components of the reaction center complex, revealing the molecular basis for the efficient electron transfer pathway .

How do mutations in the pscC gene affect electron transfer kinetics in the photosynthetic reaction center?

Mutations in the pscC gene can significantly impact electron transfer kinetics in the photosynthetic reaction center of C. tepidum. Studies involving gene inactivation have shown that PscC is crucial for mediating electron transfer from the menaquinol/cytochrome c oxidoreductase to P840 . When the pscC gene is disrupted, the electron transfer pathway is compromised, affecting the photosynthetic efficiency of the organism.

Specific mutations in conserved residues surrounding the heme-binding site can alter the redox potential of the cytochrome, thereby affecting the thermodynamics and kinetics of electron transfer. Mutations that change the spatial relationship between PscC and PscA may also disrupt the close interaction needed for efficient electron transfer between these subunits. Time-resolved spectroscopic analyses of wildtype and mutant reaction centers have revealed that the rate of re-reduction of P840+ (the oxidized special pair) is directly influenced by the properties of PscC, and mutations that affect the structure or positioning of PscC can lead to measurable changes in electron transfer rates.

The expression of recombinant PscC variants with site-directed mutations provides a powerful approach for investigating the molecular determinants of electron transfer efficiency in the reaction center complex.

What is the evolutionary significance of the homodimeric structure of the reaction center in C. tepidum compared to heterodimeric reaction centers in other photosynthetic organisms?

C. tepidum exhibits a homodimeric core structure formed by two 82 kDa PscA proteins, which differs from the heterodimeric reaction centers found in many other photosynthetic organisms . This structural difference has significant evolutionary implications. The homodimeric architecture of the C. tepidum reaction center is considered to be more primitive and may represent an ancestral form of photosynthetic reaction centers.

Comparative genomic and structural analyses suggest that heterodimeric reaction centers likely evolved from homodimeric ancestors through gene duplication and subsequent divergence. The simpler symmetrical structure of the homodimeric reaction center in C. tepidum contrasts with the more complex and asymmetric electron transfer pathways in heterodimeric reaction centers of purple bacteria, cyanobacteria, and plants.

The interaction between PscC and the homodimeric PscA core provides insights into the evolutionary adaptations that optimize electron transfer efficiency in different photosynthetic systems. Understanding these differences can contribute to our knowledge of the evolution of photosynthetic mechanisms and may inform the design of artificial photosynthetic systems for energy conversion applications.

How can researchers effectively produce and purify recombinant PscC for structural and functional studies?

Recombinant PscC production for structural and functional studies can be achieved through several complementary approaches:

  • Conjugative plasmid transfer system: Using RSF1010-derivative broad-host-range plasmids such as pDSK5191 and pDSK5192 for expression in C. tepidum . This method offers the advantage of producing the protein in its native environment, ensuring proper folding and post-translational modifications.

  • Expression construct design: The expression plasmid should incorporate:

    • The upstream region of the pscAB gene cluster (containing a constitutive promoter)

    • The pscC gene sequence (optionally with a 6xHis-tag for purification)

    • The downstream region of the pscAB gene cluster (containing a ρ-independent terminator)

  • Transformation protocol:

    • Conjugative transfer from E. coli S17-1 to C. tepidum WT2321

    • Selection with appropriate antibiotics (erythromycin for pDSK5191 or streptomycin/spectinomycin for pDSK5192)

    • Expected transformation efficiency: approximately 10^-5

  • Purification strategy for His-tagged PscC:

    StepMethodBuffer CompositionExpected Yield
    Cell lysisSonication in anaerobic conditions50 mM Tris-HCl pH 8.0, 100 mM NaCl, 1 mM PMSF-
    Membrane solubilizationDetergent extraction (0.5-1% n-dodecyl β-D-maltoside)50 mM Tris-HCl pH 8.0, 100 mM NaCl, 0.05% DDM-
    Initial purificationNi-NTA affinity chromatography50 mM Tris-HCl pH 8.0, 100 mM NaCl, 0.05% DDM, 20-250 mM imidazole gradient~4x higher than genomic expression
    Secondary purificationSize exclusion chromatography20 mM HEPES pH 7.5, 100 mM NaCl, 0.03% DDM>95% purity
  • Quality control assessments:

    • SDS-PAGE and Western blotting with anti-His antibodies

    • Heme content analysis by UV-visible spectroscopy (characteristic peaks at ~410 nm and ~550 nm)

    • Mass spectrometry to verify protein integrity and post-translational modifications

This methodology leverages the expression system established for C. tepidum and allows for the production of functional PscC in quantities sufficient for structural and biochemical analyses .

What techniques are most effective for analyzing electron transfer kinetics involving PscC in the reaction center complex?

Several specialized techniques have been developed to analyze electron transfer kinetics involving PscC in the reaction center complex:

  • Time-resolved absorption spectroscopy:

    • Allows measurement of the kinetics of P840 photo-oxidation and subsequent re-reduction by PscC

    • Typically uses laser flash photolysis with probe wavelengths specific to P840+ (oxidized special pair) and reduced/oxidized forms of cytochrome c

    • Time resolution in the nanosecond to millisecond range enables capture of the entire electron transfer process

  • Electrochemical methods:

    • Cyclic voltammetry to determine the redox potential of the heme in PscC

    • Protein film voltammetry for direct measurement of electron transfer rates

    • Correlation of measured potentials with electron transfer efficiency

  • EPR spectroscopy:

    • Characterization of the electronic structure of the heme in different oxidation states

    • Analysis of the interaction between PscC and other redox centers in the reaction center

  • Cross-linking mass spectrometry:

    • Identification of specific interaction sites between PscC and other reaction center subunits

    • The reaction center complex can be cross-linked using bissulfosuccinimidyl suberate, disuccinimidyl suberate, or 3,3-dithiobis-sulfosuccinimidyl propionate

    • Liquid chromatography coupled to tandem mass spectrometry analysis of cross-linked peptides reveals protein-protein interfaces

  • Site-directed mutagenesis combined with kinetic analysis:

    • Systematic modification of key residues in PscC to probe their role in electron transfer

    • Comparative kinetic analysis of wildtype and mutant proteins to establish structure-function relationships

These techniques, when used in combination, provide a comprehensive understanding of the electron transfer mechanisms involving PscC and how structural features influence electron transfer efficiency in the reaction center complex.

What are the most reliable methods for generating and characterizing pscC gene knockout mutants in C. tepidum?

Generating and characterizing pscC gene knockout mutants in C. tepidum can be accomplished through the following systematic approach:

  • Construct design for gene inactivation:

    • Create a construct containing an antibiotic resistance cassette (aacC1 for gentamicin resistance or aadA for streptomycin/spectinomycin resistance) flanked by homologous regions of the pscC gene

    • Optimal length of homologous flanking regions: 500-1000 bp on each side of the resistance cassette for efficient recombination

    • Clone the construct into a suitable vector like pUC19

  • Transformation methods:

    • Natural transformation: Harvest C. tepidum cells in late exponential growth phase (3-6 × 10^9 cells/ml), resuspend in 20 μl of medium containing 1 μg of linearized DNA, spot on a non-selective plate, and incubate in the dark for 1-2 hours followed by light incubation at 40°C for 18-20 hours

    • Expected transformation frequency: approximately 10^-5 to 10^-6 for fully segregated mutants

  • Selection and screening protocol:

    StepMethodExpected Result
    Primary selectionPlating on selective media with appropriate antibioticsColonies appearing after 5-6 days
    PCR screeningColony PCR with primers flanking the insertion siteWildtype: smaller band; Mutant: larger band with resistance cassette
    Southern blotGenomic DNA digestion and probing with pscC gene and resistance markerConfirmation of correct insertion location
    DNA sequencingSequencing across insertion junctionsVerification of construct integrity
  • Phenotypic characterization:

    • Growth analysis under different light intensities and sulfur sources

    • Spectroscopic analysis of the reaction center complex (absorption, fluorescence, and circular dichroism)

    • Electron transfer kinetics measurements

    • Protein composition analysis of the reaction center by SDS-PAGE and immunoblotting

  • Complementation testing:

    • Reintroduce the wildtype pscC gene using the conjugative plasmid system (pDSK5191 or pDSK5192)

    • Compare phenotypic characteristics of the complemented strain with wildtype and knockout strains

    • Confirm restoration of function through spectroscopic and kinetic analyses

This comprehensive approach ensures the reliable generation and thorough characterization of pscC gene knockout mutants in C. tepidum, providing valuable insights into the role of PscC in photosynthetic electron transfer .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.