Recombinant Chlorobium tepidum Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its inclusion in production.
Synonyms
mscL; CT1243; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Target Names
mscL
Target Protein Sequence
MLKEFREFALKGNVVDMAVGIIIGGAFGALVNSLVNDLLMPPLGLLLKGVDFSNLFVVLK EGTPPGPYIALADAKTAGAVTLNYGLFVNALIGFLIMAFAVFLLVRSINRLRSLSEKSAA PAVAPQTKECPFCFSIIPLKAVRCPNCTSQL
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It likely plays a role in regulating cellular osmotic pressure.
Database Links

KEGG: cte:CT1243

STRING: 194439.CT1243

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the mscL gene in Chlorobium tepidum?

The mscL gene (CT1243) is part of the 2.15-Mb circular chromosome of Chlorobium tepidum TLS, the first sequenced genome from the phylum Chlorobia . The gene encodes the large-conductance mechanosensitive channel, which functions in the cellular response to osmotic challenges. Within the genomic architecture, mscL exists among approximately 2,252 protein-coding genes that have been identified in the complete genome sequence . The genomic context is particularly interesting as Chlorobium tepidum represents a unique model organism for studying anoxygenic photosynthesis and osmotic regulation mechanisms in green sulfur bacteria . When designing experiments involving mscL, researchers should consider its genomic neighborhood for potential regulatory elements or operonic arrangements that might influence expression patterns.

What expression systems are optimal for producing functional recombinant Chlorobium tepidum mscL?

The established methodology for recombinant Chlorobium tepidum mscL expression utilizes E. coli as the heterologous host . This system has proven effective for producing the full-length protein (amino acids 1-151) with an N-terminal His-tag for purification purposes. When implementing this expression system, researchers should consider the following optimization parameters:

  • Induction conditions: Temperature, inducer concentration, and induction duration significantly impact the balance between expression yield and proper protein folding.

  • Host strain selection: E. coli strains with reduced proteolytic activity (e.g., BL21(DE3) derivatives) typically yield better results for membrane protein expression.

  • Membrane extraction protocol: Given that mscL is a membrane protein, detergent selection for solubilization is critical - mild detergents like DDM (n-dodecyl-β-D-maltoside) or LDAO (lauryldimethylamine oxide) often preserve functional integrity.

Alternative expression systems such as cell-free synthesis may be considered for research applications requiring specifically labeled protein (e.g., for NMR studies) or when tag-free protein is needed for certain functional assays. The natural transformability of Chlorobium tepidum itself also presents an opportunity for homologous expression experiments, leveraging the genetic tractability of this organism described in previous studies .

What are the critical considerations for maintaining protein stability during purification and storage?

Maintaining the structural and functional integrity of purified Chlorobium tepidum mscL requires careful attention to buffer composition and storage conditions. Based on established protocols, the following recommendations are essential:

  • Buffer composition: The recombinant protein demonstrates optimal stability in Tris/PBS-based buffer systems at pH 8.0, supplemented with 6% trehalose as a stabilizing agent . This formulation helps prevent aggregation and preserve the native conformation.

  • Storage protocols:

    • Short-term storage (up to one week): Maintain working aliquots at 4°C to avoid freeze-thaw damage .

    • Long-term storage: Store at -20°C/-80°C in buffer containing 5-50% glycerol (optimally 50%) as a cryoprotectant .

  • Reconstitution procedure: When using lyophilized protein:

    • Centrifuge the vial briefly before opening

    • Reconstitute to 0.1-1.0 mg/mL using deionized sterile water

    • Add glycerol to the recommended final concentration

    • Aliquot for storage to prevent repeated freeze-thaw cycles

These stability considerations are particularly important for mechanosensitive channels, as their functional properties often depend on maintaining native oligomeric states and preserving the integrity of transmembrane domains.

How can researchers effectively assess the channel functionality of recombinant Chlorobium tepidum mscL?

Evaluating the functional properties of recombinant Chlorobium tepidum mscL requires specialized techniques that can detect mechanosensitive channel activity. The following methodological approaches are recommended:

  • Patch-clamp electrophysiology: This represents the gold standard for direct measurement of channel activity. For mscL studies:

    • Reconstitute purified protein in liposomes or planar lipid bilayers

    • Apply negative pressure to the patch pipette to induce membrane tension

    • Record channel openings at different membrane tensions to characterize pressure sensitivity

    • Compare conductance levels with established mechanosensitive channels (30-40 nS for E. coli MscL)

  • Fluorescence-based assays:

    • Calcein release assay: Measure tension-dependent release of fluorescent dye from mscL-containing liposomes

    • Voltage-sensitive dye assays: Monitor membrane potential changes associated with channel activity

  • In vivo complementation studies:

    • Utilize E. coli MscL-deficient strains to test functional complementation by Chlorobium tepidum mscL

    • Assess survival rates under hypoosmotic shock conditions as a measure of functional channel expression

When interpreting functional data, it's important to consider the native environment of Chlorobium tepidum - an anaerobic, photosynthetic bacterium with unique membrane composition that may influence channel properties .

What structural assessment techniques are most suitable for Chlorobium tepidum mscL?

Understanding the structural properties of Chlorobium tepidum mscL requires a multi-technique approach that can reveal different aspects of protein conformation. These methodologies are particularly relevant:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV CD (190-250 nm): Quantifies secondary structure composition (α-helices, β-sheets)

    • Near-UV CD (250-320 nm): Provides information about tertiary structure and aromatic residue environments

    • Thermal denaturation CD: Assesses protein stability and thermodynamic parameters

  • Site-Directed Spin Labeling (SDSL) coupled with Electron Paramagnetic Resonance (EPR):

    • Strategically introduce cysteine mutations for spin label attachment

    • Measure distances between spin labels to determine conformational changes during gating

    • Particularly valuable given the presence of native cysteine residues in the C-terminal region of Chlorobium tepidum mscL

  • Cryo-Electron Microscopy:

    • Appropriate for capturing different conformational states of the channel

    • Can reveal oligomeric assembly and interaction with membrane environment

    • May be combined with lipid nanodiscs to provide a native-like membrane context

  • Molecular Dynamics Simulations:

    • Utilize the known amino acid sequence to create structural models

    • Simulate membrane tension to predict conformational changes

    • Compare with experimental results to refine structural understanding

Understanding the structural properties is essential for explaining the unique physiological role of mscL in Chlorobium tepidum, particularly considering the organism's adaptation to high-sulfide environments .

How does the Chlorobium tepidum mscL differ functionally from other bacterial mechanosensitive channels?

The Chlorobium tepidum mscL represents an interesting case for comparative analysis within the bacterial mechanosensitive channel family. Several distinguishing features have been identified:

  • Sequence divergence: The Chlorobium tepidum mscL protein shows notable differences in its C-terminal region compared to canonical mscL proteins, including unique cysteine-rich motifs (CPFCFSIIPLKAVRCPNCTSQL) . These differences likely reflect adaptations to the specific ecological niche of Chlorobium tepidum as an anaerobic photosynthetic bacterium that lives in sulfide-rich environments .

  • Gating properties comparison:

    PropertyChlorobium tepidum mscLE. coli MscLNotes
    Gating thresholdRequires experimental determination~10-12 mN/mMay differ due to native membrane composition
    ConductanceRequires experimental determination~3 nSExpected to be similar based on conserved pore regions
    Inactivation kineticsPotentially redox-regulated due to cysteine contentNot redox-sensitiveUnique feature of C. tepidum mscL
  • Environmental adaptations: The high sulfide environments in which Chlorobium tepidum naturally occurs suggest that its mscL may have evolved mechanisms to function under redox conditions different from those of model organisms like E. coli. The cysteine-rich C-terminal domain could potentially serve as a redox sensor that modulates channel activity in response to environmental redox changes.

When designing comparative studies, researchers should consider these unique features and incorporate appropriate controls to isolate the specific functional characteristics of Chlorobium tepidum mscL.

What insights does mscL provide about the osmotic adaptation of Chlorobium tepidum to its unique ecological niche?

The presence of mscL in Chlorobium tepidum offers important insights into how this specialized photosynthetic bacterium manages osmotic challenges in its natural environment:

  • Ecological context: Chlorobium tepidum was originally isolated from high-sulfide hot springs , suggesting adaptation to environments with potentially fluctuating osmotic conditions. The genome sequence analysis reveals that C. tepidum has an extensive repertoire of transporters for inorganic compounds, with almost 50% predicted to function in metal ion homeostasis .

  • Comparative genomic insights: The presence of mscL must be considered in the broader context of C. tepidum's membrane transport systems. The genome encodes numerous transporters, including six homologs of ArsA (a protein that couples arsenite efflux to ATP hydrolysis) . This expanded set of transporters likely complements the function of mechanosensitive channels in maintaining cellular homeostasis.

  • Integration with metabolic systems: Chlorobium tepidum performs anoxygenic photosynthesis using the reductive tricarboxylic acid cycle, distinguishing it from other photosynthetic organisms . This unique metabolic system may produce different osmotic challenges than those faced by model organisms, potentially requiring specialized functions from mechanosensitive channels.

  • Research opportunities: Investigating how mscL functions within the context of C. tepidum's unique physiology presents opportunities to understand mechanosensitive channel adaptation to extreme environments. This may include examining how channel activity relates to:

    • Sulfur metabolism and the handling of sulfide/polysulfide species

    • Photosynthetic activity and associated osmotic fluctuations

    • Metal ion homeostasis in high-sulfide environments

These ecological considerations highlight the importance of studying mscL not in isolation, but as part of the integrated physiological systems that allow Chlorobium tepidum to thrive in its specialized niche .

How can Chlorobium tepidum mscL be utilized for synthetic biology applications?

The unique properties of Chlorobium tepidum mscL open several promising avenues for synthetic biology applications, particularly in creating systems responsive to mechanical stimuli:

  • Engineered mechanosensitive biosensors:

    • The distinct sequence features of Chlorobium tepidum mscL, particularly the cysteine-rich C-terminal domain , provide an opportunity to develop dual-responsive channels sensitive to both membrane tension and redox conditions.

    • Experimental approach: Create fusion proteins linking mscL to reporter domains (fluorescent proteins or enzymes) that activate upon channel opening.

    • Applications: Environmental monitoring of conditions mimicking the natural habitat of Chlorobium tepidum, including redox state and pressure changes.

  • Controlled release systems:

    • Methodology: Incorporate purified Chlorobium tepidum mscL into liposomes containing encapsulated compounds.

    • Trigger release through osmotic downshift or mechanical stimulation.

    • Research application: Create biomimetic systems for fundamental studies of controlled molecular release.

  • Comparative structure-function studies:

    • The unique cysteine-rich motifs in Chlorobium tepidum mscL (CPFCFSIIPLKAVRCPNCTSQL) can serve as a platform for understanding how redox sensitivity might be engineered into other mechanosensitive channels.

    • Experimental approach: Generate chimeric channels incorporating the C-terminal domain of C. tepidum mscL into well-characterized channels from model organisms.

  • Expression system considerations:

    • When using recombinant protein for these applications, researchers should follow the established protocols for producing functional protein, including expression in E. coli and purification with the N-terminal His-tag .

    • For applications requiring untagged protein, consider implementing protease cleavage sites or alternative purification strategies.

These applications leverage the natural adaptations of Chlorobium tepidum to its unique ecological niche while providing tools for both fundamental research and potential biotechnological applications.

What experimental strategies can address the potential redox sensitivity of Chlorobium tepidum mscL?

The presence of multiple cysteine residues in the C-terminal region of Chlorobium tepidum mscL (CPFCFSIIPLKAVRCPNCTSQL) suggests potential redox sensitivity that merits detailed investigation. The following experimental approaches are recommended:

  • Site-directed mutagenesis studies:

    • Systematically replace cysteine residues (individually and in combination) with serine or alanine.

    • Assess channel function under various redox conditions using electrophysiological methods.

    • Expected outcome: Identification of specific cysteine residues critical for redox sensitivity.

    MutationPredicted EffectExperimental Readout
    C138SDisrupt first CPFC motifAltered redox sensitivity in patch-clamp
    C141SDisrupt first CPFC motifAltered redox sensitivity in patch-clamp
    C148SDisrupt second CPNC motifAltered redox sensitivity in patch-clamp
    C151SDisrupt second CPNC motifAltered redox sensitivity in patch-clamp
    All-Cys-to-SerComplete removal of redox sensitivityBaseline for comparison
  • Thiol-specific chemical modification:

    • Use thiol-reactive compounds (maleimides, methanethiosulfonates) to covalently modify cysteine residues.

    • Measure changes in channel activity following modification.

    • Conduct under both reducing and oxidizing conditions to assess accessibility changes.

  • Metal binding assays:

    • The arrangement of cysteines suggests potential metal coordination (e.g., zinc finger-like motifs).

    • Investigate channel modulation by different metal ions using:

      • Isothermal titration calorimetry (ITC) to measure binding affinities

      • Functional assays in the presence/absence of specific metals

      • Competitive metal chelation studies

  • Integration with physiological context:

    • Examine channel function under conditions mimicking the high-sulfide environment where Chlorobium tepidum naturally occurs .

    • Test hypothesis that redox sensitivity might coordinate channel activity with photosynthetic electron transport or sulfur metabolism.

These experimental approaches address a potentially unique aspect of Chlorobium tepidum mscL that may represent an adaptation to its specialized ecological niche as an anaerobic photosynthetic bacterium in sulfide-rich environments .

What are the common challenges in functionally reconstituting Chlorobium tepidum mscL into artificial membrane systems?

Researchers working with Chlorobium tepidum mscL often encounter several technical challenges when attempting functional reconstitution into artificial membrane systems. Here are the key issues and recommended solutions:

  • Protein denaturation during solubilization and reconstitution:

    • Problem: Mechanosensitive channels are particularly sensitive to detergent-induced denaturation.

    • Solution: Use mild detergents (DDM, LDAO) at minimal effective concentrations. The recommended reconstitution protocol for Chlorobium tepidum mscL involves carefully controlling detergent concentration and implementing a staged removal process .

    • Verification method: Circular dichroism spectroscopy to confirm retention of secondary structure elements before and after reconstitution.

  • Inconsistent protein orientation in liposomes:

    • Problem: Random orientation of inserted channels complicates functional analysis.

    • Solution: Implement asymmetric reconstitution protocols using His-tag directed insertion methods. The N-terminal His-tag on the recombinant protein can be leveraged for oriented reconstitution.

    • Quality control: Conduct protease protection assays to verify orientation distribution.

  • Membrane composition effects on channel function:

    • Problem: Chlorobium tepidum's native membrane environment differs significantly from standard reconstitution lipids.

    • Solution: Systematically test varied lipid compositions, particularly including:

      • Anionic lipids (PS, PG) at different percentages

      • Lipids with varied acyl chain lengths and saturations

      • Potential incorporation of native lipid extracts from Chlorobium tepidum

    • Analysis method: Compare pressure-response curves across different membrane compositions.

  • Storage stability of reconstituted proteoliposomes:

    • Problem: Functional decay during storage of prepared samples.

    • Solution: Optimize stabilization protocols, including:

      • Addition of trehalose (6%) as a stabilizing agent

      • Flash-freezing in liquid nitrogen for long-term storage

      • Storage of small aliquots to minimize freeze-thaw cycles

    • Validation: Test activity retention after defined storage periods.

These methodological considerations address the specific challenges of working with Chlorobium tepidum mscL, acknowledging both the general difficulties of membrane protein reconstitution and the particular characteristics of this protein from an anaerobic photosynthetic bacterium .

How can researchers address the challenge of distinguishing Chlorobium tepidum mscL activity from other mechanosensitive channels in experimental systems?

When studying Chlorobium tepidum mscL, ensuring specific detection of its activity distinct from other mechanosensitive channels presents several challenges. The following methodological approaches help address this issue:

  • Electrophysiological fingerprinting:

    • Challenge: Distinguishing Chlorobium tepidum mscL conductance patterns from endogenous channels.

    • Solution: Establish a characteristic electrophysiological profile by:

      • Determining specific single-channel conductance values

      • Measuring unique gating kinetics parameters

      • Characterizing distinctive voltage dependence patterns

      • Identifying specific inhibitor/modulator responses, particularly those that might interact with the cysteine-rich C-terminal domain

    ParameterExpected RangeDistinguishing Features
    ConductanceTo be experimentally determinedCompared to E. coli MscL (~3 nS)
    Pressure thresholdTo be experimentally determinedRelative to membrane thickness and composition
    Redox sensitivityLikely high due to C-terminal cysteinesUnique feature not present in most MS channels
  • Genetic and molecular controls:

    • Challenge: Ensuring that observed activity comes from the recombinant protein.

    • Solutions:

      • Use channel-null expression systems (E. coli, Xenopus oocytes with endogenous channels deleted)

      • Implement mutations that confer distinctive properties (e.g., GOF mutations that lower activation threshold)

      • Utilize epitope tags for immunolocalization to confirm expression and proper targeting

      • Employ the N-terminal His-tag not just for purification but also as a tool for specific channel inhibition (e.g., Ni2+ binding studies)

  • Biochemical verification approaches:

    • Challenge: Confirming the molecular identity of functionally detected channels.

    • Solutions:

      • Western blot analysis of experimental preparations using antibodies against the recombinant protein

      • Mass spectrometry verification of purified protein identity and integrity

      • Cross-linking studies to verify oligomeric state before functional analysis

These methodological considerations ensure rigorous attribution of observed mechanosensitive channel activity to the recombinant Chlorobium tepidum mscL, preventing experimental artifacts and misinterpretation of results when studying this unique protein from an ecologically specialized bacterium .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.