Recombinant Chlorobium tepidum Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Role in Bacterial Physiology and Pathogenicity

LspA is indispensable for lipoprotein maturation, which is critical for bacterial envelope integrity, virulence, and antibiotic resistance. For example:

  • Pseudomonas aeruginosa: LspA knockout strains show impaired biofilm formation and reduced antibiotic resistance .

  • Staphylococcus aureus: lspA mutants exhibit increased β-lactam susceptibility and altered cell wall teichoic acid (WTA) synthesis .

Impact of LspA Inhibition (Globomycin):

OrganismPhenotypeSource
Pseudomonas aeruginosaGrowth inhibition, reduced virulence
Staphylococcus aureusEnhanced β-lactam efficacy
Rickettsia typhiReduced host cell invasion

Recombinant Production and Biotechnological Applications

Recombinant LspA proteins are pivotal for studying enzymatic mechanisms and drug targeting. The Chlorobium phaeobacteroides LspA variant (RFL17596CF) is available as a His-tagged protein (>90% purity), enabling biochemical assays and structural studies .

Applications of Recombinant LspA:

  1. Enzyme Kinetics: Characterizing substrate specificity and inhibition by globomycin derivatives .

  2. Drug Discovery: Screening for novel LspA inhibitors to combat antibiotic-resistant pathogens .

Research Gaps and Future Directions

While C. tepidum LspA remains understudied, its homologs in other species suggest conserved roles. Priorities include:

  1. Genomic Analysis: Identifying lspA in C. tepidum and its regulatory networks (e.g., oxygen stress responses) .

  2. Structural Studies: Resolving the crystal structure of C. tepidum LspA to inform inhibitor design.

  3. Ecological Relevance: Linking LspA activity to C. tepidum’s anaerobic photosynthesis and sulfur metabolism .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify this in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request; please contact us in advance as additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
lspA; CT1810; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Target Names
lspA
Target Protein Sequence
MALFYLLAIAAALLDRVTKLLAIHYLRDGAQSIVIIPDWLKLTYAENLGIAFSVRFLPPT GLLFLTLAISAGVVWYVHKSNNRSPLFLTAFGLILGGGIGNLIDRVMLGHVVDFIYFDLY HGALFGIPLDLWPIFNVADSCITIGACMIVLFHEKIFTRKHA
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links

KEGG: cte:CT1810

STRING: 194439.CT1810

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is lipoprotein signal peptidase (LspA) and what is its functional role in bacteria?

Lipoprotein signal peptidase (LspA) is an essential enzyme in the bacterial lipoprotein processing pathway that cleaves the signal peptide from prolipoproteins after they have been lipidated by prolipoprotein diacylglyceryl transferase (Lgt). This processing step is crucial for the proper localization and function of bacterial lipoproteins, which play diverse roles in cellular processes including envelope stability, nutrient acquisition, and virulence.

In Gram-negative bacteria such as E. coli and P. aeruginosa, LspA is essential for viability, while in Gram-positive bacteria like S. aureus, it contributes significantly to virulence without being strictly essential for growth under laboratory conditions . The enzyme belongs to the aspartic protease family and contains multiple transmembrane domains that anchor it within the bacterial membrane where it processes its lipoprotein substrates.

The critical importance of LspA is demonstrated by survival studies showing that LspA-deficient mutants of S. aureus exhibit severely reduced ability to persist in human blood compared to wild-type strains, although they can grow normally in laboratory media . The compromised survival in blood reflects the enzyme's importance in maintaining envelope integrity under physiologically relevant conditions.

How does the structure of LspA relate to its function in bacterial systems?

LspA is a membrane-embedded aspartic protease with multiple transmembrane domains arranged to form a substrate-binding pocket within the membrane. Crystal structures of LspA from S. aureus have revealed critical structural features that likely apply to homologs across bacterial species, including Chlorobium tepidum.

A particularly important structural element is the extracellular loop (EL), an 11-residue sequence that displays remarkable flexibility. This flexibility appears essential for enzyme function, as it allows accommodation of various substrate lipoproteins. In S. aureus LspA, glycine 54 in this loop is critical for this flexibility, and mutating it to proline (which restricts conformational flexibility) completely abolishes enzyme activity .

The catalytic mechanism involves two aspartic acid residues that coordinate a water molecule for nucleophilic attack on the scissile bond of the substrate. The binding pocket accommodates the lipidated N-terminus of the prolipoprotein and positions the cleavage site appropriately for catalysis. The precise architecture of this pocket determines both substrate specificity and susceptibility to inhibitors like globomycin and myxovirescin.

Why is Chlorobium tepidum an interesting model organism for studying LspA?

Chlorobium tepidum represents an excellent model organism for studying LspA in the context of thermophilic photosynthetic bacteria for several reasons. C. tepidum is a thermophilic green sulfur bacterium originally isolated from New Zealand hot springs that grows optimally at elevated temperatures (around 40°C) . This thermophilic nature suggests that its enzymes, including LspA, may have evolved unique structural adaptations for function at higher temperatures.

Additionally, C. tepidum is naturally transformable and relatively easy to cultivate compared to other green sulfur bacteria, making it amenable to genetic manipulation for studying protein function . Its complete genome sequence (2,154,946 bp) was the first sequenced in the phylum Chlorobia, providing a solid foundation for molecular studies .

The distinctive physiology of C. tepidum—including its anoxygenic photosynthesis, sulfur metabolism, and unique light-harvesting complexes (chlorosomes)—creates a different cellular environment for LspA function compared to well-studied pathogens like S. aureus . This allows researchers to explore how LspA function may be adapted to different physiological contexts and environmental conditions.

What methods are used to detect and quantify LspA activity?

Detection and quantification of LspA activity can be accomplished through several complementary approaches:

  • Gel-shift assays: This coupled assay system measures the processing of a model prolipoprotein substrate (such as proICP) by LspA. The reaction typically involves:

    • Incubation of the prolipoprotein substrate with purified Lgt to generate the LspA substrate

    • Addition of purified LspA to catalyze signal peptide cleavage

    • Analysis by SDS-PAGE to detect the mobility shift between the precursor and processed forms of the lipoprotein

    • Quantification of band intensities to determine reaction kinetics

  • Fluorescence resonance energy transfer (FRET) assays: This approach utilizes synthetic FRET lipopeptide substrates containing a fluorophore-quencher pair separated by the LspA cleavage site. Upon cleavage, the fluorophore is separated from the quencher, resulting in increased fluorescence that can be monitored in real-time .

  • Inhibition studies: LspA activity can be characterized indirectly by measuring its inhibition by known inhibitors such as globomycin or myxovirescin. Dose-response curves with varying inhibitor concentrations allow determination of IC50 values and inhibition mechanisms .

For recombinant C. tepidum LspA specifically, these assays would need to be optimized for the enzyme's temperature optimum (likely around 40°C) and other biochemical requirements specific to this thermophilic organism.

What are the optimal expression and purification strategies for recombinant Chlorobium tepidum LspA?

Based on successful approaches with other bacterial LspA proteins, the following strategies are recommended for expression and purification of recombinant Chlorobium tepidum LspA:

Expression Systems:

  • E. coli-based in vivo expression: Using E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3), or Lemo21(DE3)) with vectors containing inducible promoters (T7 or arabinose-inducible) and a C-terminal hexahistidine tag for purification .

  • Cell-free expression systems: For challenging membrane proteins, cell-free systems can offer advantages by avoiding potential toxicity issues associated with overexpression in living cells.

Expression Optimization Parameters:

  • Induction at lower temperatures (16-25°C)

  • Reduced inducer concentrations

  • Extended expression periods (16-24 hours)

  • Supplementation with lipids to stabilize the membrane protein

Purification Protocol:

  • Membrane fraction isolation using ultracentrifugation

  • Solubilization with detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for further purification and assessment of oligomeric state

  • Optional ion exchange chromatography step if higher purity is required

Critical Considerations for C. tepidum LspA:

  • Being from a thermophilic organism, C. tepidum LspA may exhibit higher stability at elevated temperatures (around 40°C), which could be advantageous during purification

  • Detergent selection may need optimization specific to this ortholog

  • Buffer systems should account for the native pH environment of C. tepidum

Successful expression and purification can be validated through Western blotting, mass spectrometry, and functional assays as described in question 1.4.

How do temperature and pH affect the activity and stability of Chlorobium tepidum LspA?

As Chlorobium tepidum is a thermophilic bacterium that grows optimally at 40°C, its LspA enzyme likely exhibits distinctive temperature-dependence profiles compared to mesophilic homologs :

Temperature Effects:

  • The optimal temperature for C. tepidum LspA activity is likely to be between 40-50°C, reflecting its adaptation to the organism's growth temperature

  • At temperatures below 30°C, activity may be significantly reduced

  • Thermal stability is expected to be higher than mesophilic homologs, potentially maintaining structural integrity at temperatures up to 60°C

pH Dependence:

  • Optimal activity is anticipated in the slightly alkaline range (pH 7.5-8.5), consistent with the physiological pH of C. tepidum growth conditions

  • C. tepidum thrives in environments with significant sulfide concentrations, suggesting its enzymes, including LspA, may be adapted to function in the presence of reduced sulfur compounds

Experimental Approach to Characterize Temperature and pH Dependencies:

  • Activity assays across temperature range: Conduct standard LspA activity assays (gel-shift or FRET-based) at temperatures ranging from 20-60°C to identify the optimal temperature

  • Thermal stability assays: Use differential scanning fluorimetry or circular dichroism spectroscopy to determine the melting temperature (Tm) and thermal denaturation profile

  • pH-activity profile: Perform activity assays in buffer systems spanning pH 5.0-9.0 to determine the pH optimum and range

  • Long-term stability studies: Assess activity retention after prolonged incubation at different temperatures to evaluate thermal stability over time

These parameters are particularly important when considering the enzyme's potential applications in thermostable biocatalysis or structural biology studies.

How do the kinetic parameters of C. tepidum LspA compare with homologs from other bacterial species?

The kinetic properties of LspA enzymes vary significantly between bacterial species, reflecting adaptations to different physiological contexts. While specific data for C. tepidum LspA is limited, useful comparisons can be made based on data from other bacterial homologs:

ParameterS. aureus LspAP. aeruginosa LspAExpected C. tepidum LspA
Km (μM) - FRET substrate471020-50 (estimated)
Vmax (nmol/mg·min) - FRET substrate2.51075-20 (estimated)
Optimal enzyme concentration (μM)0.3-0.50.1-0.50.2-0.5 (estimated)
IC50 for globomycin (μM)171 (with proICP substrate)0.64 (with proICP substrate)Unknown

Based on the available data, S. aureus LspA exhibits lower substrate affinity and significantly lower catalytic efficiency compared to the P. aeruginosa enzyme . C. tepidum LspA, being from a thermophilic organism, might exhibit distinctive kinetic properties:

  • Potentially lower catalytic efficiency at lower temperatures but increased efficiency at its physiological temperature (40°C)

  • Possibly lower substrate affinity (higher Km) as a trade-off for enhanced thermostability

  • Different inhibitor sensitivity profiles to molecules like globomycin, reflecting structural adaptations to thermophilic environments

The divergent kinetic properties observed between S. aureus and P. aeruginosa LspA suggest that ortholog-specific factors significantly influence enzyme behavior. This highlights the importance of direct experimental characterization of C. tepidum LspA rather than relying solely on extrapolation from other species .

What structural adaptations might C. tepidum LspA possess for thermostability?

As a protein from a thermophilic organism, C. tepidum LspA likely incorporates several structural adaptations that enhance thermostability while preserving catalytic function at elevated temperatures:

Anticipated Thermostability Features:

  • Increased hydrophobic core packing: Enhanced van der Waals interactions in the protein core that strengthen as temperature increases

  • Higher proportion of charged residues on the protein surface, forming networks of ionic interactions (salt bridges) that stabilize the folded state

  • Reduction in thermolabile residues such as asparagine and glutamine, which are prone to deamidation at high temperatures

  • Decreased loop flexibility in non-functional regions, while maintaining essential flexibility in catalytic domains like the EL loop that is crucial for substrate binding

  • Increased proline content in turns and loops, restricting conformational flexibility and enhancing structural rigidity

  • Distinctive membrane interaction domains: Potentially containing adaptations in transmembrane helices that maintain optimal interaction with lipids at elevated temperatures

  • Disulfide bonds: Potential introduction of additional disulfide linkages that stabilize tertiary structure

Experimental Approaches to Characterize Thermostability Features:

  • Comparative homology modeling based on existing LspA structures to identify potential thermostability determinants

  • Hydrogen-deuterium exchange mass spectrometry to map regions of differential flexibility compared to mesophilic homologs

  • Site-directed mutagenesis of predicted thermostability-conferring residues followed by thermal stability assays

  • X-ray crystallography or cryo-EM studies to determine the high-resolution structure and compare with mesophilic homologs

Understanding these adaptations could inform protein engineering efforts to enhance the stability of LspA enzymes from mesophilic organisms for biotechnological applications .

How might the light-harvesting machinery of C. tepidum influence LspA expression and function?

C. tepidum possesses a sophisticated photosynthetic apparatus centered around unique light-harvesting complexes called chlorosomes, which are essential for its energy metabolism . This photosynthetic lifestyle may influence LspA expression and function through several interconnected mechanisms:

Potential Influences of Photosynthetic Machinery on LspA:

  • Light-dependent regulation: LspA expression may be coordinated with the expression of photosynthetic machinery components, many of which are lipoproteins requiring processing by LspA. Research in C. tepidum has shown that light intensity affects the expression of numerous genes, potentially including those involved in envelope maintenance .

  • Integration with redox signaling: The photosynthetic electron transport chain generates a complex redox environment that may influence LspA activity through post-translational modifications or altered membrane properties. Experiments could examine whether LspA activity changes under different light conditions that alter cellular redox status.

  • Membrane composition effects: C. tepidum's photosynthetic machinery involves specialized membrane structures and lipid compositions that could affect the local environment of membrane-embedded LspA. The chlorosomes of C. tepidum contain bacteriochlorophylls and carotenoids that create a unique membrane context .

  • Temperature influence: The absorption of light energy by chlorosomes can create localized temperature gradients in the membrane that might affect the activity of nearby enzymes like LspA. Recent studies on the photosynthetic mechanism in C. tepidum have shown that excitation energy is delocalized over the chlorosome in <1 ps at room temperature, and exciton transfer to the baseplate occurs in ∼3 to 5 ps .

Experimental Approaches to Investigate These Relationships:

  • Comparative transcriptomics and proteomics under varying light conditions to assess co-regulation of LspA with photosynthetic components

  • Analysis of LspA activity in membranes derived from cells grown under different light regimes

  • Examination of potential lipoprotein substrates involved in photosynthesis or chlorosome assembly

  • Investigation of membrane microdomain association of LspA in relation to photosynthetic complexes

This interplay between photosynthetic machinery and lipoprotein processing represents a fascinating area for future research that could reveal novel regulatory mechanisms specific to photosynthetic bacteria like C. tepidum .

What screening approaches can identify potential inhibitors of C. tepidum LspA?

Developing screening approaches for C. tepidum LspA inhibitors requires consideration of the enzyme's thermophilic nature and potentially unique structural features. The following methodological approaches are recommended:

Primary Screening Methodologies:

  • FRET-based high-throughput screening: Utilizing fluorogenic peptide substrates containing the LspA cleavage site flanked by a fluorophore-quencher pair. This approach enables real-time monitoring of enzymatic activity in a multiwell plate format suitable for screening compound libraries .

  • Thermal shift assays: Compounds that bind to and stabilize LspA will typically increase its thermal denaturation temperature. This method can be implemented using differential scanning fluorimetry with a hydrophobic fluorescent dye like SYPRO Orange.

  • In silico screening: Molecular docking studies targeting the substrate-binding pocket identified from homology models based on S. aureus LspA crystal structures. This approach could prioritize compounds for biochemical testing.

Secondary Validation Assays:

  • Gel-shift assay with natural substrate: Confirming hits from primary screens using a more physiologically relevant prolipoprotein substrate like proICP in a gel-based assay .

  • Isothermal titration calorimetry: Determining binding thermodynamics of promising inhibitor candidates.

  • X-ray crystallography: Obtaining co-crystal structures with lead inhibitors to enable structure-based optimization.

Special Considerations for C. tepidum LspA:

  • All screening assays should be conducted at 40°C to reflect the physiological temperature of C. tepidum .

  • The screening buffer should mimic the ionic and pH environment of C. tepidum.

  • Comparison of inhibition profiles with mesophilic LspA homologs could identify C. tepidum-specific inhibitors.

A particularly interesting avenue would be exploring whether inhibitors that target the "19-atom motif" shared between globomycin and myxovirescin in their binding to S. aureus LspA also effectively inhibit C. tepidum LspA, which would suggest conservation of this structural feature across diverse bacterial phyla .

What approaches can be used to identify the lipoprotein substrates of C. tepidum LspA?

Identifying the natural lipoprotein substrates of C. tepidum LspA requires integrating computational prediction with experimental validation. The following methodological framework is recommended:

Computational Prediction:

  • Lipoprotein prediction algorithms: Tools such as LipoP, PRED-LIPO, or DOLOP can analyze the C. tepidum genome to identify putative lipoproteins based on signal peptide characteristics and lipobox motifs .

  • Comparative genomics: Identifying C. tepidum homologs of known lipoproteins from other bacteria, particularly those involved in photosynthesis and sulfur metabolism.

  • Structural prediction: Using AlphaFold or similar tools to predict structures of candidate lipoproteins and assess the accessibility of potential lipoboxes.

Experimental Validation:

  • Proteomics approach:

    • Metabolic labeling of lipoproteins using azide-modified fatty acids followed by click chemistry

    • Comparison of membrane proteomes between wild-type C. tepidum and an lspA knockout strain

    • Mass spectrometry identification of accumulated prolipoproteins in cells treated with LspA inhibitors

  • Directed mutagenesis and in vitro processing:

    • Cloning and expression of predicted C. tepidum lipoproteins

    • In vitro processing assays with purified recombinant LspA

    • Site-directed mutagenesis of putative lipoboxes to confirm specificity

  • In vivo validation:

    • Construction of reporter fusions to candidate lipoprotein signal peptides

    • Monitoring processing and localization in both C. tepidum and heterologous hosts

Expected Substrate Classes:

Based on knowledge of other bacterial systems and C. tepidum biology, likely substrate categories include:

  • Photosynthetic apparatus components and assembly factors

  • Sulfur oxidation pathway enzymes

  • Nutrient transport systems

  • Cell envelope maintenance proteins

  • Stress response mediators adapted to thermophilic conditions

Understanding the lipoprotein substrate profile of C. tepidum LspA would provide insights into its specialized role in this photosynthetic thermophile and potentially reveal novel lipoproteins involved in its unique ecological adaptations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.