Recombinant Chlorobium tepidum Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to YidC Insertases

YidC is a universally conserved membrane protein insertase critical for the co-translational integration of transmembrane proteins into bacterial membranes . In Chlorobium tepidum, a thermophilic green sulfur bacterium, YidC facilitates the insertion of photosynthetic machinery components and enzymes involved in sulfur metabolism . Recombinant YidC enables in vitro studies of its structural and functional mechanisms, providing insights into membrane protein biogenesis in anaerobic photosynthetic organisms.

Functional Role in C. tepidum

YidC in C. tepidum is essential for:

  • Photosystem Assembly: Co-translational insertion of chlorophyll synthase (ChlG) and light-harvesting complexes into thylakoid membranes .

  • Sulfur Metabolism: Integration of sulfur-oxidizing enzymes critical for anaerobic photosynthesis .

  • Substrate Specificity: Recognition of Sec-independent substrates, such as small hydrophobic proteins, via its amphiphilic groove .

Substrate Interaction

  • YidC binds nascent transmembrane helices via its hydrophilic groove, enabling partial insertion into the lipid bilayer .

  • Hydrophobic mismatch between YidC’s TM domains and the membrane induces bilayer thinning (7–10 Å), reducing energy barriers for substrate insertion .

Role in Photosynthesis

  • Co-purifies with chlorophyll synthase (ChlG) and high-light-inducible proteins (HLIPs), suggesting a role in coordinating chlorophyll delivery during photosystem assembly .

  • Facilitates the integration of bacteriochlorophyll (BChl) biosynthesis enzymes into thylakoid membranes .

Sec-Independent Insertion

  • Reconstituted YidC proteoliposomes catalyze the insertion of Sec-independent substrates (e.g., Pf3 coat protein) at a stoichiometry of ~150 substrates per YidC molecule .

Comparative Analysis with Other Insertases

FeatureYidCSecYEG Translocon
MechanismInsertion at protein-lipid interface Aqueous channel with lateral gate
Substrate PreferenceSmall, hydrophobic proteins Large, multi-pass transmembrane proteins
Cofactor RequirementNone (monomeric activity) Requires SecA ATPase and chaperones

Research Implications and Applications

  • Biotechnological Tool: Recombinant YidC enables in vitro reconstitution of membrane protein insertion, aiding drug discovery for bacterial pathogens .

  • Evolutionary Studies: Homologs in mitochondria (Oxa1) and chloroplasts (Alb3) highlight conserved mechanisms across domains of life .

Future Directions

  • Structural Dynamics: High-resolution cryo-EM studies of C. tepidum YidC-substrate complexes are needed to resolve insertion intermediates .

  • Functional Genomics: Gene knockout studies in C. tepidum could clarify YidC’s role in chlorosome biogenesis and sulfur cycling .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; CT0006; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-590
Protein Length
full length protein
Species
Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Target Names
yidC
Target Protein Sequence
MDRNSVIGFALIAAIMIVWLQFMKPEQKLGLEKAAASREAVQKTPAAALPAPSAAVAAAA RADSLGSFAQASVGTEKTITVSNDLFTATLSSKGATLKSLVLKKHLDGNRKPFNLISASD KGALSMLFLSSDGKKIDTRDLYFRSLDAKTTETVTGKEKLSVSYVLDVDATRSIQITYTF TGDSYVVDYDLKLNGFGSSIAGNEYQLDWDGGLNYSEKDQVDESHNAIASAYLGGSVVKL DAKDAKKTWQDEESGKAQWVAVRNKYFVAAIMPQRTTDGIYLHGTKKDGSDFKNYVAALK MSFPAGQQSVDDHYRLYVGPLDYNTVKSLNADLEKIMDFGWDWLTRPFAEYLILPIFNWM NKYVTNYGLIIIIFAFLIKLVTWPLSLASTKSMKKMSALQPVMKELQEKYKDNPAKLQSE LGRIYKEAGVNPLGGCLPTVIQMPLLFAMFYVFRSSIQLRQHGFLWVKDLSVPDSVYHFA FKLPLYGDHIAIMPILMAVTVFFQQKITPNAQSNEQTKIMMWLFPAMMLFFFNNMPAGLA LYYLMFNIFSVAQQAYMNATITDEEKAAAAMQVAAATKPAQSAKKGGKKK
Uniprot No.

Target Background

Function
This protein is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It is involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. It assists in the folding of multispanning membrane proteins.
Database Links

KEGG: cte:CT0006

STRING: 194439.CT0006

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what are its primary functions in bacterial cells?

YidC is a membrane protein insertase belonging to the YidC/Oxa1/Alb3 family that plays essential roles in membrane protein biogenesis. In bacteria like Chlorobium tepidum, YidC serves two critical functions. First, it acts as a membrane-protein chaperone that facilitates proper folding and assembly of proteins in cooperation with the Sec translocon, preventing protein misfolding by limiting nonspecific interactions between transmembrane segments . Second, YidC independently mediates the insertion of certain membrane proteins through a Sec-independent pathway, particularly for single or double membrane-spanning proteins such as the F₀ subunit c of ATP synthase, subunit II of cytochrome o oxidase (CyoA), and the mechanosensitive channel MscL . These functions are essential for bacterial cell viability, as demonstrated by multiple studies showing that YidC depletion leads to growth arrest and eventual cell death .

How does the structure of YidC contribute to its function?

YidC typically contains five conserved transmembrane helices that are essential for its insertion and chaperoning functions. In Bacillus halodurans YidC2, these five transmembrane domains are preceded by an N-terminal region that may undergo post-translational modification, specifically lipid modification after cleavage by a type II signal peptidase . X-ray crystallography studies have provided structural insights at 2.4 Å resolution, revealing how these transmembrane domains are arranged to create a hydrophilic groove that likely facilitates the insertion of client proteins into the lipid bilayer . The C-terminal region of YidC contains disordered residues that can impact crystallization quality, as researchers found that truncating these disordered C-terminal residues (creating constructs such as YidC 27-261 and YidC 27-266) improved crystal formation and diffraction quality .

What is known about Chlorobium tepidum as a model organism for YidC studies?

Chlorobium tepidum is a thermophilic green sulfur bacterium originally isolated from New Zealand hot springs. It represents an excellent model system for studying YidC for several reasons. C. tepidum is easily cultivated in laboratory conditions and is naturally transformable, making it amenable to genetic manipulation . The organism has a single circular chromosome of 2,154,946 base pairs, and its genome was the first sequenced in the phylum Chlorobia . This bacterium grows in dense mats over hot springs and other warm environments containing sufficient hydrogen sulfide, which it uses as an electron donor . C. tepidum's photosynthetic lifestyle and thermophilic nature present unique membrane protein requirements that make its YidC particularly interesting for comparative studies with mesophilic bacteria, potentially offering insights into adaptations of the membrane protein insertion machinery to different environmental conditions.

What expression systems are optimal for recombinant YidC production?

Successful expression of recombinant YidC requires careful consideration of expression hosts and conditions to accommodate its membrane protein nature. From the search results, E. coli has proven effective for heterologous expression of YidC proteins, including those from Chlorobium chlorochromatii . When establishing an expression system, researchers should consider using vectors that incorporate affinity tags for purification, such as His-tags positioned either at the N-terminus (following a cleavable signal sequence) or at the C-terminus . For screening purposes, fusion constructs with reporter proteins like GFP can be valuable, as demonstrated in the study of B. halodurans YidC2 where C-terminally GFP-His₈-tagged constructs facilitated identification of well-expressing and stable protein variants through fluorescent size-exclusion chromatography (FSEC) . Temperature optimization is critical, with reduced temperatures (typically 18-25°C) often yielding better results for membrane protein expression by slowing protein production and allowing proper membrane integration.

What purification strategies yield the highest purity and functional stability for YidC?

Purification of YidC requires specialized approaches due to its hydrophobic nature as a membrane protein. Based on the research with B. halodurans YidC2, a three-step purification protocol has proven effective :

  • Membrane solubilization using appropriate detergents - most notably, a combination of n-dodecyl-β-D-maltopyranoside (DDM) supplemented with cholesteryl hemisuccinate (CHS) significantly improved protein stability compared to DDM alone .

  • Affinity chromatography using Ni-NTA resin for His-tagged constructs, with careful buffer optimization including:

    • 20 mM Tris-HCl pH 8.0

    • 300 mM NaCl

    • 20 mM imidazole in washing buffer

    • 300 mM imidazole for elution

    • Maintaining detergent concentrations (0.1% DDM, 0.01% CHS) throughout

  • Size-exclusion chromatography as a final polishing step using columns such as Superdex 200 to separate monomeric protein from aggregates and other contaminants .

For tag removal, incorporation of a protease cleavage site (e.g., TEV protease site) between the tag and the protein allows for removal of the affinity tag after initial purification, followed by a second affinity step to separate the cleaved protein from the protease and uncleaved material .

How can researchers assess and optimize protein stability during YidC purification?

Assessing and optimizing YidC stability throughout the purification process is critical for structural and functional studies. Researchers studying B. halodurans YidC2 discovered that protein stability was significantly enhanced by including cholesteryl hemisuccinate (CHS) in the detergent solution, which prevented aggregation that occurred when using DDM alone . This represents an important finding, as CHS was previously known to stabilize G-protein-coupled receptors but had not been widely reported for bacterial membrane proteins .

Monitoring techniques for stability assessment include:

  • Fluorescent size-exclusion chromatography (FSEC) for initial screening of constructs and conditions when using GFP-fusion proteins .

  • Analytical size-exclusion chromatography to assess monodispersity and detect aggregation over time.

  • Thermal stability assays such as differential scanning fluorimetry to identify buffer and additive conditions that enhance protein stability.

  • Limited proteolysis to identify stable protein domains and optimize construct design.

For long-term storage, researchers should evaluate cryoprotectants such as glycerol (typically 20-50%) and determine optimal concentration through stability trials . Additionally, concentrating the protein to appropriate levels (6 mg/ml was used for crystallization studies of B. halodurans YidC2) without inducing aggregation requires careful optimization of buffer conditions, including reduced ionic strength during final dialysis (1 mM Tris-HCl pH 8.0, 0.05% DDM, 0.005% CHS) .

What crystallization methods have proven most successful for YidC structural studies?

The lipidic cubic phase (LCP) crystallization method has proven particularly successful for YidC structural determination, as demonstrated in the crystallization of B. halodurans YidC2 . This technique is especially suitable for membrane proteins as it provides a native-like lipid environment. Key factors that influenced crystallization success included:

  • Protein engineering approaches:

    • Introduction of a His₈ tag followed by a TEV protease cleavage site between residues 26 and 27 to remove potentially lipid-modified N-terminal residues

    • C-terminal truncation to remove disordered regions (creating constructs like YidC 27-261 and YidC 27-266) that improved crystal quality

  • Crystallization conditions optimization:

    • Initial plate-shaped crystals were obtained in 20% PEG 400, 50 mM Na MES pH 6.5, 30 mM MgCl₂, 1 mM CdCl₂

    • Improved cuboid-shaped crystals formed in 30% PEG 500 DME, 1 mM CdCl₂, 100 mM buffer

  • Heavy atom derivatization:

    • For phase determination, researchers used site-directed mutagenesis to introduce single cysteine residues at strategic positions for mercury derivatization

    • These derivatives were prepared by incubating the protein with 2 mM methylmercury chloride at room temperature for 1 hour prior to crystallization

The crystals obtained through these methods diffracted X-rays to 2.4 Å resolution and belonged to space group P2₁, with unit-cell parameters a = 43.9, b = 60.6, c = 58.9 Å, β = 100.3°, enabling successful structural determination through multiwavelength anomalous diffraction .

What advanced biophysical techniques can provide insights into YidC function beyond crystallography?

While X-ray crystallography has provided valuable static structural information on YidC , several complementary biophysical techniques can offer additional insights into YidC dynamics and function:

  • Cryo-electron microscopy (cryo-EM): This technique can capture YidC in different conformational states and in complex with substrate proteins or other components of the translocation machinery, potentially revealing mechanistic details of the insertion process.

  • Nuclear magnetic resonance (NMR) spectroscopy: For studying dynamic regions and conformational changes, particularly in truncated constructs or specific domains of YidC.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of YidC that undergo conformational changes upon substrate binding or interaction with other proteins.

  • Single-molecule Förster resonance energy transfer (smFRET): By introducing fluorescent labels at specific positions, researchers can monitor distance changes between regions of YidC during its functional cycle.

  • Electron paramagnetic resonance (EPR) spectroscopy: Site-directed spin labeling combined with EPR can provide information about the local environment and dynamics of specific residues in YidC.

These techniques can complement structural data from crystallography to build a more comprehensive understanding of YidC function, particularly regarding its dynamic interactions with substrate proteins and other components of the membrane protein insertion machinery.

How can protein engineering approaches enhance structural studies of YidC?

Strategic protein engineering has proven critical for successful structural studies of YidC proteins. Based on the experiences with B. halodurans YidC2, several approaches have shown particular promise :

  • Terminal modifications:

    • N-terminal engineering: Introducing a TEV protease cleavage site after residue 26 allowed removal of the signal peptide region that may undergo lipid modification, reducing heterogeneity

    • C-terminal truncation: Removing predicted disordered regions (residues beyond position 261 or 266) improved crystal quality and diffraction resolution

  • Affinity tag positioning:

    • Strategic placement of His₈ tags followed by protease cleavage sites allowed for efficient purification while minimizing impact on protein function

    • In the B. halodurans YidC2 study, positioning the tag between residues 26 and 27 proved effective

  • Site-directed mutagenesis for phase determination:

    • Introduction of single cysteine residues at carefully selected positions enabled mercury derivatization for experimental phasing

    • These modifications must be designed to minimize functional impact while ensuring accessibility for heavy atom binding

  • Stability engineering:

    • Screening multiple bacterial homologs (researchers tested 26 thermophilic and halophilic bacteria) through FSEC analysis to identify naturally stable variants

    • Selecting thermophilic variants like those from B. halodurans can provide inherently more stable starting points for structural studies

These engineering approaches significantly impact the likelihood of obtaining high-quality crystals suitable for structure determination, as demonstrated by the difference in diffraction quality between the initial construct (diffracting to only ~5 Å) and the engineered variant (diffracting to 2.4 Å) .

What experimental approaches can elucidate YidC's role in membrane protein insertion?

Several experimental approaches can be employed to investigate YidC's role in membrane protein insertion:

  • In vivo depletion studies:

    • Constructing conditional YidC depletion strains and monitoring the effects on various substrate proteins

    • Analyzing accumulation of uninserted membrane proteins and changes in membrane proteome composition

  • Reconstitution systems:

    • Purifying YidC and reconstituting it into proteoliposomes

    • Measuring insertion of fluorescently labeled substrate proteins and analyzing insertion kinetics and efficiency

    • Determining the effects of lipid composition on YidC-mediated insertion

  • Crosslinking assays:

    • Using site-specific photocrosslinking to identify contact points between YidC and substrate proteins during the insertion process

    • Mapping the insertion pathway by crosslinking at different time points during translation

  • FRET-based approaches:

    • Labeling YidC and substrate proteins with fluorescent probes to monitor real-time insertion events

    • Analyzing conformational changes in YidC during substrate binding and insertion

  • Cryo-electron microscopy:

    • Capturing YidC-ribosome-nascent chain complexes to visualize the insertion process

    • Structural analysis of YidC in complex with different substrate proteins at various insertion stages

These approaches can provide insights into the molecular mechanisms of both Sec-dependent and Sec-independent insertion pathways mediated by YidC, particularly for important substrate proteins such as the F₀ subunit c of ATP synthase and subunit II of cytochrome o oxidase .

How does YidC cooperate with the Sec translocon in membrane protein biogenesis?

YidC cooperation with the Sec translocon represents a sophisticated mechanism for ensuring proper membrane protein integration. Based on the available research, this cooperation involves several key aspects:

  • Sequential handover mechanism:

    • YidC transiently receives transmembrane (TM) segments released from the Sec translocon (SecYEG in bacteria)

    • This transfer helps prevent protein misfolding by minimizing nonspecific interactions with other TM segments

  • Integration with auxiliary components:

    • YidC interacts with the proton-driven SecDF complex, which may participate in this Sec-dependent pathway

    • These interactions create a larger membrane protein biogenesis network that coordinates the activities of multiple insertion/folding factors

  • Chaperone function:

    • Beyond insertion, YidC facilitates proper folding and assembly of complex membrane proteins

    • This function is particularly important for energy-transducing membrane protein complexes such as the F₁F₀ ATP synthase and respiratory chain components

  • Substrate specificity determinants:

    • The decision between Sec-dependent (with YidC assistance) versus Sec-independent (YidC-only) pathways depends on specific features of the substrate proteins

    • These features include hydrophobicity, charge distribution, and topological complexity of the transmembrane domains

Research approaches to study this cooperation include in vitro reconstitution systems combining purified Sec translocon and YidC components, crosslinking studies to capture transient interactions, and genetic studies examining synthetic phenotypes when components of both systems are compromised.

What factors determine substrate specificity for YidC-mediated membrane protein insertion?

Understanding the determinants of substrate specificity for YidC is crucial for predicting which membrane proteins utilize YidC-dependent pathways. Several factors influence whether a protein will be inserted via the Sec-dependent or Sec-independent YidC pathway:

  • Transmembrane domain characteristics:

    • Proteins with fewer transmembrane segments (single or double spanning) are more likely to use the YidC-only pathway

    • Specific examples include the F₀ subunit c of ATP synthase, subunit II of cytochrome o oxidase (CyoA), and the mechanosensitive channel MscL

  • Charge distribution:

    • The distribution of charged residues, particularly positively charged residues following the "positive inside rule," influences pathway selection

    • Transmembrane segments with fewer charged residues may preferentially use the YidC-only pathway

  • Hydrophobicity profile:

    • Moderately hydrophobic transmembrane segments often require YidC assistance

    • Extremely hydrophobic segments may insert spontaneously or require different chaperones

  • Structural complexity:

    • Proteins with complex folding requirements or multiple domains typically require the coordinated action of both Sec and YidC systems

    • Simpler proteins may be accommodated by YidC alone

  • Evolutionary conservation:

    • Analysis of Chlorobium tepidum's genome reveals duplications of genes involved in biosynthetic pathways for photosynthesis and metabolism of sulfur and nitrogen

    • These duplications may influence which insertion pathways are utilized for specific proteins in this organism

Research approaches to identify YidC substrates include comparative proteomic analysis of membrane fractions under YidC-depleted conditions, in vitro insertion assays with purified components, and bioinformatic analyses to identify potential YidC recognition motifs in substrate proteins.

How can computational approaches contribute to understanding YidC function and substrate interactions?

Computational approaches offer powerful tools for studying YidC function and interactions:

  • Molecular dynamics simulations:

    • All-atom simulations of YidC embedded in lipid bilayers can reveal conformational dynamics and potential substrate interaction sites

    • Coarse-grained simulations can model longer-timescale processes such as complete substrate insertion events

  • Homology modeling and evolutionary analysis:

    • Comparative modeling of Chlorobium tepidum YidC based on known structures from other organisms (like B. halodurans)

    • Analysis of evolutionary conservation patterns to identify functionally important residues

    • Chlorobium tepidum's genome analysis has already revealed interesting conservation patterns among photosynthetic species

  • Protein-protein docking:

    • In silico modeling of YidC interactions with substrate proteins and other components of the translocation machinery

    • Identification of potential binding interfaces and key interaction residues

  • Machine learning approaches:

    • Development of predictive algorithms for identifying YidC substrates based on sequence features

    • Analysis of large datasets to identify patterns in YidC-dependent membrane protein insertion

  • Quantum mechanics/molecular mechanics (QM/MM) studies:

    • For investigating specific chemical aspects of YidC function, such as proton transfer events or other catalytic processes that might facilitate membrane protein insertion

These computational approaches complement experimental methods and can guide hypothesis generation for targeted experimental validation, particularly in understanding how YidC from thermophilic organisms like Chlorobium tepidum may differ functionally from mesophilic counterparts.

What are the implications of YidC research for understanding membrane protein disorders and developing therapeutics?

Research on bacterial YidC proteins has broader implications for understanding membrane protein biogenesis disorders and therapeutic development:

  • Evolutionary conservation in protein insertion machinery:

    • YidC belongs to the YidC/Oxa1/Alb3 family, with homologs in mitochondria (Oxa1) and chloroplasts (Alb3)

    • Understanding the bacterial system provides insights into evolutionary conservation of insertion mechanisms across domains of life

  • Disease relevance:

    • Defects in human homologs of membrane protein insertion machinery are associated with various disorders

    • Bacterial models using YidC can serve as simplified systems for understanding fundamental mechanisms that may be conserved in human disorders

  • Antibiotic development potential:

    • YidC is essential for bacterial viability, making it a potential antibiotic target

    • Understanding the structural and functional differences between bacterial YidC and eukaryotic homologs could enable development of specific inhibitors

    • Chlorobium tepidum's thermophilic nature may provide insights into developing thermostable therapeutics or biotechnology applications

  • Membrane protein production applications:

    • Insights from YidC research inform strategies for improved recombinant membrane protein production

    • Co-expression with engineered YidC variants could enhance yields of difficult-to-express membrane proteins for structural studies or therapeutic applications

These translational aspects of YidC research highlight the importance of fundamental membrane protein biology studies for addressing broader biomedical challenges.

How can YidC research inform synthetic biology approaches to membrane protein engineering?

YidC research provides valuable insights for synthetic biology applications focused on membrane protein engineering:

  • Enhanced membrane protein expression systems:

    • Co-expression of YidC with target membrane proteins can improve folding and insertion efficiency

    • Engineering YidC variants with broader substrate specificity could create more versatile expression hosts

    • Understanding the special characteristics of YidC from extremophiles like the thermophilic Chlorobium tepidum could inspire design of expression systems for challenging membrane proteins

  • Minimal cell design:

    • YidC is part of the core machinery required for membrane protein biogenesis

    • Research defines the minimal components needed for functional membrane protein insertion in synthetic cell systems

  • Designer membrane protein insertion systems:

    • Structure-function insights from YidC enable rational design of insertion machinery with altered properties

    • Engineered YidC variants could allow insertion of non-natural amino acid-containing proteins or completely synthetic transmembrane segments

  • Biosensor development:

    • YidC-based systems could be engineered to report on membrane protein folding states

    • Such biosensors could aid in screening libraries of membrane protein variants for improved properties

  • Biomimetic materials:

    • Understanding how YidC facilitates membrane protein insertion informs design of artificial systems for incorporating proteins into synthetic membranes

    • These materials could have applications in drug delivery, biocatalysis, and bioelectronics

The detailed structural information available for YidC family members , combined with functional insights, provides a foundation for these synthetic biology applications, potentially enabling novel approaches to persistent challenges in membrane protein engineering.

What protein-specific optimizations improve recombinant YidC yield and quality?

Several protein-specific optimizations can significantly enhance the yield and quality of recombinant YidC:

Optimization StrategyImplementation ApproachExpected Outcome
Construct designIntroduction of TEV protease site after residue 26; C-terminal truncation to remove disordered regions (e.g., YidC 27-266) Improved protein homogeneity and crystallization properties
Expression conditionsLow-temperature induction (18-25°C); careful media optimization including potential supplementation with extra nitrogen sourcesReduced inclusion body formation; improved membrane integration
Detergent selectionDDM (0.1%) supplemented with CHS (0.01%) for solubilization and purification Significantly enhanced protein stability and reduced aggregation
Buffer optimizationFinal dialysis in low ionic strength buffer (1 mM Tris-HCl pH 8.0) Improved crystallization outcomes and stability
Affinity tag positioningStrategic placement at N-terminus after signal sequence rather than C-terminus Improved accessibility for purification while maintaining function
Homolog screeningFSEC analysis of multiple bacterial homologs to identify naturally stable variants Identification of constructs with superior expression and stability

As demonstrated in research with B. halodurans YidC2, these optimizations can dramatically improve outcomes, enabling successful structural studies that would otherwise be challenging with poorly optimized constructs .

What emerging technologies show promise for advancing YidC functional studies?

Several emerging technologies hold particular promise for advancing functional studies of YidC proteins:

  • Advanced membrane mimetics:

    • Nanodiscs with defined lipid compositions to study lipid-dependence of YidC function

    • Polymer-encapsulated membrane proteins (SMALP, DIBMA) that allow extraction of YidC with its native lipid environment preserved

  • Single-molecule techniques:

    • Optical tweezers to study the forces involved in YidC-mediated membrane protein insertion

    • Single-molecule tracking to visualize YidC dynamics in living cells

  • Time-resolved structural methods:

    • Time-resolved cryo-EM to capture different conformational states during the insertion process

    • Serial femtosecond crystallography at X-ray free electron lasers (XFELs) to visualize conformational changes in real-time

  • Advanced mass spectrometry:

    • Cross-linking mass spectrometry to map interaction networks of YidC with substrates and other insertion machinery components

    • Native mass spectrometry to analyze intact membrane protein complexes involving YidC

  • CRISPR-based approaches:

    • CRISPRi for controlled depletion studies with minimal polar effects

    • CRISPR-mediated genome editing to introduce mutations or tags at the endogenous locus

These technologies promise to overcome current limitations in studying the dynamic aspects of YidC function and could provide unprecedented insights into the molecular mechanisms of membrane protein insertion and folding mediated by this essential protein family.

How can researchers troubleshoot common challenges in YidC experimental studies?

Researchers working with YidC proteins frequently encounter specific challenges that require targeted troubleshooting approaches:

ChallengePotential CausesTroubleshooting Strategies
Poor expression yieldToxicity from membrane protein overexpression; improper signal sequence processingTry different promoter strengths; optimize induction conditions; screen multiple constructs with varying N-terminal designs
Protein aggregation during purificationDetergent instability; inadequate solubilizationSupplement DDM with CHS (0.01%) as demonstrated for B. halodurans YidC2 ; screen alternative detergents; consider styrene-maleic acid copolymer extraction
Low functional activity of purified proteinDetergent-induced conformational changes; loss of essential lipidsReconstitute into proteoliposomes with defined lipid composition; identify and add specific lipids required for activity
Difficulty obtaining diffraction-quality crystalsProtein heterogeneity; conformational flexibilityEngineer constructs to remove disordered regions (as with YidC 27-266); try lipidic cubic phase crystallization; address post-translational modifications
Challenges in identifying YidC substratesFunctional redundancy; transient interactionsUse quantitative proteomics comparing wild-type and YidC-depleted conditions; apply proximity labeling approaches to identify transient interaction partners
Inconsistent reconstitution resultsVariation in proteoliposome preparation; incomplete protein incorporationStandardize reconstitution protocols; measure protein:lipid ratios; verify correct orientation using protease protection assays

These troubleshooting approaches draw on successful strategies reported in the literature, particularly the improvements in protein stability achieved through CHS supplementation and construct optimization in the B. halodurans YidC2 study .

What are the most promising areas for future YidC research?

Several research directions hold particular promise for advancing our understanding of YidC biology:

  • Comparative studies of YidC from diverse bacterial species:

    • Investigating functional differences between YidC from thermophiles like Chlorobium tepidum versus mesophiles

    • Understanding how different environmental adaptations influence YidC structure and function

  • Comprehensive substrate identification:

    • Systems-level approaches to define the complete YidC "clientome" in different bacterial species

    • Determining how substrate profiles differ between organisms with different metabolic lifestyles

  • Detailed mechanism of membrane protein insertion:

    • Elucidating the precise steps and conformational changes during YidC-mediated insertion

    • Understanding the energetics of insertion and the potential role of proton motive force

  • Interaction networks:

    • Mapping the complete interactome of YidC in different bacterial species

    • Identifying novel interaction partners beyond the known Sec translocon components

  • Therapeutic targeting:

    • Exploring YidC as an antibiotic target given its essential nature

    • Developing high-throughput screens for YidC inhibitors

These research directions would benefit from integrating multiple approaches, including structural biology, functional assays, computational modeling, and systems biology, to build a comprehensive understanding of YidC biology across different bacterial species and contexts.

How might research on Chlorobium tepidum YidC specifically contribute to the broader understanding of membrane protein biogenesis?

Research on Chlorobium tepidum YidC offers unique opportunities to advance the field of membrane protein biogenesis:

  • Thermophilic adaptations:

    • As a thermophilic organism originally isolated from New Zealand hot springs , C. tepidum's YidC likely possesses adaptations for function at higher temperatures

    • Understanding these adaptations could inform protein engineering efforts to enhance stability of membrane insertion machinery

  • Photosynthetic specializations:

    • C. tepidum has special light-harvesting complexes called chlorosomes containing bacteriochlorophylls and carotenoids

    • Studying how YidC contributes to assembly of these specialized photosynthetic membrane complexes could reveal new insights into co-factor integration during membrane protein biogenesis

  • Evolutionary insights:

    • Phylogenomic analysis has shown that C. tepidum contains duplications of genes involved in biosynthetic pathways for photosynthesis and metabolism of sulfur and nitrogen

    • Investigating whether these duplications extend to membrane insertion machinery could reveal functional specialization of YidC paralogs

  • Extreme environment adaptation:

    • C. tepidum grows in environments with high hydrogen sulfide content, which it uses as an electron donor

    • Research could reveal how YidC functions in membrane environments adapted to these extreme conditions

  • Cross-species comparison:

    • Comparative studies between C. tepidum YidC and homologs from other species (like the crystallized B. halodurans YidC2 ) could identify conserved versus variable features

    • Such comparisons would help define the core mechanistic principles of YidC function across diverse bacterial lineages

These contributions would expand our understanding of how membrane protein insertion machinery adapts to different physiological contexts while maintaining its essential functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.