Recombinant Chlorobium tepidum NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chlorobium tepidum NuoK

Recombinant Chlorobium tepidum NADH-quinone oxidoreductase subunit K (nuoK) is a recombinant protein derived from the green sulfur bacterium Chlorobium tepidum. It is a component of Complex I (NADH-quinone oxidoreductase), a critical enzyme in bacterial electron transport chains. The protein is encoded by the nuoK gene (UniProt ID: Q8KEB6) and belongs to the NDH-1 family of proton-pumping NADH dehydrogenases .

Key Features

ParameterDetail
LengthFull-length (1–107 amino acids)
TagN-terminal His-tag for purification
Expression HostEscherichia coli
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Amino Acid SequenceMLTQQLLSIGVNHFLTISVILFGLGMFAVMTRKNAIVILMGVELILNAANINFLTFSKYN GGMEGVMFSLFVIVLAAAEAAIALAIVINIFKTFKTVDVSSVDTMKE

Genomic Context

The nuoK gene is part of an operon (ndhCHJKAIGEFDB, CT0766–CT0776) encoding 11 subunits of the NDH-1 complex in C. tepidum . Notably, this operon lacks homologs of E. coli NuoEFG subunits, distinguishing it from other bacterial Complex I systems .

Protein Structure

  • Hydrophobicity: The sequence contains hydrophobic stretches (e.g., VILFGLGMFAVMTRK), suggesting transmembrane domains critical for membrane anchoring .

  • Conserved Motifs: Residues such as Phe and Leu in helical regions (e.g., VILFGLGM) align with structural motifs in NDH-1 subunits from related organisms .

Functional Role

  • Electron Transfer: Subunit K (nuoK) contributes to the proton-pumping function of NDH-1, facilitating electron transfer from NADH to quinones in C. tepidum’s anaerobic electron transport chain .

  • Phylogenetic Significance: The nuoK gene shows closer homology to archaeal NADH dehydrogenases than to E. coli, reflecting lateral gene transfer events in Chlorobia .

Genome-Scale Insights

  • Operon Organization: The ndh operon in C. tepidum is conserved with other green sulfur bacteria but lacks subunits NuoEFG, suggesting a streamlined Complex I architecture .

  • Metabolic Linkages: NDH-1 activity in C. tepidum is integrated with the reductive tricarboxylic acid (TCA) cycle, supporting anoxygenic photosynthesis via ferredoxin-dependent reactions .

Experimental Data

PropertyObservation
Expression ProfilenuoK transcripts are constitutively expressed under phototrophic conditions .
Purification EfficiencyHis-tagged recombinant nuoK is soluble and purified via nickel affinity chromatography .
StabilityLyophilized protein remains stable at -20°C/-80°C; repeated freeze-thaw cycles reduce activity .

Recombinant Production

  • Host System: Expressed in E. coli with a His-tag for easy purification .

  • Yield and Purity: High yields (>90% purity) enable structural and functional studies .

Research Applications

  • Structural Biology: Cryo-EM studies of NDH-1 in C. tepidum utilize recombinant subunits to resolve membrane topology and quinone-binding sites .

  • Biochemical Assays: Purified nuoK is used to study proton translocation and electron transfer kinetics in vitro .

References

  1. Recombinant Protein Specifications: Creative BioMart (2025) – Product RFL16562CF .

  2. Genomic Context: Genome sequence of C. tepidum TLS (2002) .

  3. Structural Insights: Cryo-EM studies of NDH-1 in Chlorobaculum tepidum .

  4. Metabolic Pathways: Integration of NDH-1 with the reductive TCA cycle .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; CT0773; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Target Names
nuoK
Target Protein Sequence
MLTQQLLSIGVNHFLTISVILFGLGMFAVMTRKNAIVILMGVELILNAANINFLTFSKYN GGMEGVMFSLFVIVLAAAEAAIALAIVINIFKTFKTVDVSSVDTMKE
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's primary electron acceptor is believed to be a menaquinone. It couples the redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy in a proton gradient.
Database Links

KEGG: cte:CT0773

STRING: 194439.CT0773

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chlorobium tepidum NADH-quinone oxidoreductase subunit K?

Chlorobium tepidum NADH-quinone oxidoreductase subunit K (nuoK) is a membrane-embedded protein component of the type I NADH dehydrogenase (NDH-1) complex found in this green-sulfur bacterium. The protein is encoded by the ndhK gene (CT0770) within the ndhCHJKAIGEFDB operon that encodes 11 subunits of the NDH-1 complex. This operon appears structurally similar to those found in other photosynthetic organisms but notably lacks homologs of the Escherichia coli proteins NuoEFG, suggesting specialized adaptation to the organism's unique photosynthetic metabolism .

How does the genomic context of nuoK relate to its function?

The nuoK gene exists within an apparent operon structure (CT0766-CT0776) that is followed by genes encoding an Ni-Fe uptake hydrogenase (CT0777) and an associated b-cytochrome (CT0778). This genomic arrangement suggests a structural and functional relationship between the NADH dehydrogenase complex and hydrogen metabolism in C. tepidum. The organization of these genes indicates that they may be co-regulated and functionally integrated in the organism's electron transport system, potentially allowing coordination between different metabolic pathways during anaerobic photosynthesis .

What distinguishes the NDH-1 complex in C. tepidum from other organisms?

The NDH-1 complex in C. tepidum shows several distinctive features compared to those in non-photosynthetic bacteria. Similar to Synechocystis sp. PCC6803, it lacks homologs of the E. coli proteins NuoEFG, which are typically involved in NADH binding. This suggests that the complex may have alternative electron input modules adapted to the organism's unique photosynthetic electron transport chain. The proximity of genes encoding hydrogenase components implies potential interactions between these systems that may be absent in aerobic organisms, reflecting adaptations to C. tepidum's anaerobic lifestyle and its ability to utilize alternative electron donors such as sulfide .

What expression systems are optimal for recombinant C. tepidum nuoK?

For optimal heterologous expression of C. tepidum nuoK, E. coli-based systems modified for membrane protein expression are recommended. The most effective approach involves using E. coli C41(DE3) or C43(DE3) strains with expression vectors containing tightly regulated promoters. Based on successful expression of other C. tepidum membrane proteins, such as sulfide:quinone oxidoreductase (SQR), a C-terminal His6-tag can facilitate detection and purification. Expression should be conducted at lower temperatures (16-18°C) with reduced inducer concentrations to minimize formation of inclusion bodies. Verification of membrane localization is essential, as demonstrated with other C. tepidum membrane proteins where both the protein and its associated enzymatic activity were confirmed to be membrane-bound .

How can protein-protein interactions within the NDH-1 complex be studied?

To investigate protein-protein interactions involving nuoK within the NDH-1 complex, researchers should employ a combination of approaches. Co-immunoprecipitation using epitope-tagged nuoK can identify direct binding partners. Bacterial two-hybrid systems modified for membrane proteins can screen for interactions in vivo. Cross-linking studies using bifunctional reagents followed by mass spectrometry can map interaction interfaces. For structural insights, blue native PAGE can preserve complex integrity while separating intact NDH-1 from other membrane complexes. Conditional expression systems where nuoK levels can be modulated would reveal assembly dependencies. These methods have proven effective for analyzing membrane protein complexes in other photosynthetic bacteria and could be adapted specifically for C. tepidum nuoK research .

What approaches can verify functional integration of recombinant nuoK?

Verification of functional integration requires both biochemical and genetic approaches. Complementation studies in nuoK-deficient mutants provide the most direct evidence of functionality. Activity assays measuring electron transfer from NADH to quinone analogs in membrane preparations containing the recombinant protein can confirm biochemical function. Comparative spectroscopic analysis between wild-type and recombinant nuoK-containing membranes can detect changes in electron transfer kinetics. Researchers should also consider monitoring proton translocation using pH-sensitive fluorescent dyes to verify that the proton-pumping function of the complex remains intact. These approaches should be conducted under anaerobic conditions to mimic the natural environment of C. tepidum and prevent potential oxidative damage to the complex .

How does nuoK contribute to electron transport in C. tepidum?

The nuoK subunit likely plays a critical role in C. tepidum's electron transport chain by forming part of the membrane domain of the NDH-1 complex. Based on studies of related complexes, nuoK is expected to contribute to proton translocation across the membrane, thereby helping to establish the proton gradient necessary for ATP synthesis. In C. tepidum's unique anoxygenic photosynthetic system, the NDH-1 complex may function differently than in aerobic organisms, potentially participating in cyclic electron flow rather than linear electron transport. The complex appears to interact with ferredoxins and specialized electron carriers involved in the reverse TCA cycle used by C. tepidum for carbon fixation, suggesting nuoK may be part of an adapted electron transport system optimized for anaerobic photosynthesis .

What is known about the relationship between NDH-1 and sulfur metabolism?

C. tepidum can use sulfide as both an electron donor for photosynthesis and a sulfur source. The genome encodes multiple sulfide-oxidizing enzymes, including three sulfide:quinone oxidoreductase (SQR) homologs (CT0117, CT0876, and CT1087). Experimental evidence confirms that CT0117 and CT1087 function as SQR proteins in C. tepidum, with CT1087 being expressed specifically during active sulfide oxidation. The NDH-1 complex containing nuoK may interact with these SQR proteins in the membrane, facilitating electron transfer from sulfide to the quinone pool and subsequently to the photosynthetic reaction center. This potential interaction between NDH-1 and sulfur metabolism represents an important adaptation to C. tepidum's ecological niche in sulfide-rich environments .

How might the NDH-1 complex interact with other electron transport components?

The NDH-1 complex in C. tepidum likely forms part of an integrated electron transport network that includes unique components adapted for anaerobic photosynthesis. Based on genome analysis, potential interaction partners include the three highly similar 8Fe-8S bacterial ferredoxins (CT1260, CT1261, and CT1736) that function as soluble electron carriers from reaction centers. The complex may also interface with the recently characterized ferredoxin:NADP+ oxidoreductase (FNR) activity associated with CT1512. Unlike in aerobic organisms, electrons from the NDH-1 complex in C. tepidum are probably directed primarily toward generating reduced ferredoxins for driving the reductive reactions of the reverse TCA cycle rather than toward oxygen reduction. These specialized interactions reflect C. tepidum's adaptation to anoxygenic photosynthesis .

How can mutagenesis approaches reveal nuoK structure-function relationships?

Systematic mutagenesis studies of C. tepidum nuoK can provide critical insights into its structure-function relationships. Targeted mutations of conserved residues in transmembrane domains can identify amino acids essential for proton translocation. Researchers should focus on charged residues that might form part of proton channels and on conserved residues at subunit interfaces. Creating chimeric proteins that swap domains between nuoK and homologs from non-photosynthetic bacteria can identify regions specialized for function in anaerobic photosynthesis. Construction of point mutations that mimic those found in complex I disorders in mitochondrial homologs can reveal evolutionary conservation of mechanistic features. For each mutant, complementation studies in nuoK deletion strains followed by detailed biochemical characterization of electron transfer rates and proton translocation efficiency will establish correlations between structural elements and function .

What methodologies can resolve the membrane topology of nuoK?

Resolving the membrane topology of nuoK requires combining computational prediction with experimental verification. Researchers should first use multiple topology prediction algorithms to generate a consensus model of transmembrane segments. This model can be experimentally tested using a PhoA/LacZ fusion approach, where the activities of these reporter enzymes depend on their cellular location (periplasmic vs. cytoplasmic). Cysteine scanning mutagenesis followed by accessibility studies with membrane-permeable and impermeable sulfhydryl reagents can map exposed regions. Protease protection assays using proteases that cannot cross the membrane can identify exposed loops. For higher resolution structural information, researchers should pursue cryo-electron microscopy of the entire NDH-1 complex, which has successfully revealed the structure of related complexes in other organisms. These combined approaches will generate a comprehensive topological map of nuoK in the membrane .

How might NDH-1 complex composition adapt to changing environmental conditions?

The composition and expression of the NDH-1 complex in C. tepidum likely undergoes regulation in response to environmental conditions. Research methodologies to investigate this adaptation should include quantitative proteomics comparing NDH-1 subunit abundance under varying light intensities, sulfide concentrations, and alternative electron donor availability. Transcriptional analysis using RNA-Seq can reveal whether the ndhCHJKAIGEFDB operon is differentially regulated under these conditions. Researchers should develop reporter gene fusions to monitor promoter activity in vivo under different growth conditions. Post-translational modifications that might regulate complex activity can be identified using phosphoproteomics and other modification-specific analyses. These approaches, similar to those used to demonstrate condition-specific expression of sulfide:quinone oxidoreductase in C. tepidum, will reveal how this organism optimizes electron transport to thrive in its ecological niche .

How does nuoK from C. tepidum compare with homologs from other organisms?

Table 1: Comparative Analysis of NADH-quinone oxidoreductase subunit K across Species

OrganismGene NameLength (aa)Predicted TM DomainsKey Conserved FeaturesPhysiological Context
C. tepidumndhK (CT0770)1003Conserved charged residues in TM domainsAnaerobic photosynthesis
E. colinuoK1003Q/N-rich loop between TM2-TM3Aerobic respiration
Synechocystis sp.ndhK1053Extended N-terminal regionOxygenic photosynthesis
MitochondrialND4L983Highly conserved E/D residues in TM2Oxidative phosphorylation
Archaeal homologsVarious95-1103High similarity to C. tepidumVarious metabolic contexts

This table highlights the conservation of key structural features of nuoK across diverse organisms while noting adaptations specific to different metabolic contexts. The significant similarity between C. tepidum nuoK and archaeal homologs supports the genome analysis finding that suggests potential lateral gene transfer events in the evolution of C. tepidum's metabolic capabilities .

What expression conditions optimize recombinant nuoK production?

Table 2: Optimized Expression Conditions for Recombinant C. tepidum nuoK

ParameterOptimal ConditionEffect on ExpressionVerification Method
Expression strainE. coli C43(DE3)Reduced toxicity of membrane proteinCell growth curve
VectorpET28a with C-terminal His6-tagEnables detection and purificationWestern blot
Growth temperature18°C post-inductionPrevents inclusion body formationMembrane fraction analysis
Inducer concentration0.2 mM IPTGBalances expression level and proper foldingActivity assays
Growth mediaTB supplemented with 1% glucoseImproves membrane protein yieldTotal protein quantification
Harvest time16-20 hours post-inductionMaximizes properly folded proteinSDS-PAGE analysis
Membrane extraction100,000 × g ultracentrifugationIsolates membrane fractionEnzymatic activity tests

These optimized conditions are based on successful approaches used for other membrane proteins from C. tepidum, particularly the membrane-localized SQR proteins that have been successfully expressed with C-terminal His6-tags and verified for both membrane localization and enzymatic activity .

What novel approaches could advance understanding of nuoK within photosynthetic electron transport?

Future research on C. tepidum nuoK should exploit emerging technologies to resolve its role in photosynthetic electron transport. Single-molecule fluorescence resonance energy transfer (FRET) studies could track conformational changes during the catalytic cycle in real-time. Native mass spectrometry techniques adapted for membrane complexes could determine the stoichiometry and stability of subunit interactions. Integrating computational approaches such as molecular dynamics simulations with experimental structural data would provide insights into proton translocation mechanisms. Development of nanodiscs containing the isolated NDH-1 complex would enable detailed functional studies in a controlled membrane environment. These approaches would move beyond traditional biochemical methods to achieve a dynamic understanding of how nuoK contributes to C. tepidum's unique ability to perform anaerobic photosynthesis using reduced sulfur compounds as electron donors .

How might understanding nuoK contribute to synthetic biology applications?

Research on C. tepidum nuoK has potential applications in synthetic biology, particularly for engineering novel electron transport pathways. Detailed characterization of how this subunit functions in an anaerobic photosynthetic context could inform the design of artificial electron transport chains for bioproduction under oxygen-limited conditions. The ability to manipulate proton translocation through engineered nuoK variants could allow fine-tuning of the proton motive force for optimal production of target compounds. Understanding the integration of NDH-1 with sulfide oxidation pathways might enable the development of bioremediation systems that couple pollutant degradation to energy conservation. These applications require methodical research approaches beginning with structure-function analysis of nuoK and progressing to controlled expression in heterologous systems where its activity can be monitored and optimized for specific applications .

What is the evolutionary significance of nuoK conservation across diverse organisms?

The evolutionary history of nuoK presents intriguing research questions. Phylogenomic analysis reveals that many genes involved in C. tepidum's photosynthetic and sulfur metabolism pathways show strong similarities to those in Archaeal species, suggesting potential lateral gene transfer events. Research methodologies to explore this should include comprehensive phylogenetic analysis of nuoK sequences across bacterial and archaeal lineages to identify potential horizontal gene transfer events. Synteny analysis comparing the genomic context of nuoK across species can reveal conservation or rearrangement of the NDH operon structure. Detailed structural comparison between bacterial and archaeal homologs might identify signature adaptations to different membrane environments or metabolic contexts. This evolutionary perspective could provide insights into how electron transport chains have been adapted through evolution to support diverse metabolic lifestyles, from aerobic respiration to anaerobic photosynthesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.