Recombinant Chlorobium tepidum Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Prolipoprotein Diacylglyceryl Transferase (Lgt)

Prolipoprotein diacylglyceryl transferase (Lgt) is an essential bacterial enzyme responsible for the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of a conserved cysteine residue in prolipoproteins. This modification is critical for anchoring lipoproteins to the bacterial membrane, enabling their proper localization and function .

2.2. Comparative Genomics

The C. tepidum genome (2.15 Mbp) encodes metabolic pathways for photosynthesis, sulfur oxidation, and nitrogen fixation . While no explicit lgt gene annotation is available in the provided genomic data, phylogenetic profiling suggests the presence of conserved lipoprotein processing machinery, given the bacterium’s reliance on membrane-bound enzymes for chlorosome assembly and sulfur metabolism .

3.1. Expression Systems

Recombinant Lgt enzymes from related species (e.g., N. multiformis) are produced in E. coli with N-terminal His-tags for affinity purification . A hypothetical workflow for C. tepidum Lgt would involve:

StepDescription
Gene CloningAmplify lgt from C. tepidum genomic DNA and clone into an E. coli vector.
Recombinant ExpressionInduce expression under a strong promoter (e.g., T7/lac).
Protein PurificationUse nickel-affinity chromatography for His-tagged Lgt.
Functional AssaysValidate activity via lipid transfer assays or complementation studies .

3.2. Key Challenges

  • Membrane Localization: Recombinant Lgt requires proper membrane integration for activity, complicating solubility and purification .

  • Conserved Motifs: Mutagenesis studies in E. coli highlight residues essential for catalysis; analogous residues in C. tepidum Lgt would need verification .

Research Gaps and Future Directions

  • Direct Characterization: No peer-reviewed studies explicitly describe C. tepidum Lgt purification or activity. Genomic data (e.g., ) and homology modeling could guide targeted gene identification.

  • Metabolic Context: C. tepidum’s unique sulfur-oxidation pathways and photosynthetic machinery suggest Lgt may play specialized roles in membrane protein maturation, warranting investigation.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will preferentially develop the specified tag.
Synonyms
lgt; CT1090; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Target Names
lgt
Target Protein Sequence
MIDFTTWWQHLPSQMNPVIFSIDGIAIRWYGTMYIVAFAIVYLLSKYRISNEKLPFDKTF PGDALTWAMGGVLIGGRIGYILFYGFDWFLQDPVGTLIPIKFGNGSCAFSGINGMSFHGG LIGVAIALWLFTRTHKVDFLKTVDLFIPALPLGYTFGRLGNFINGELYGRVTTSAIGMYF PAAPTVALRHPSQLYEAFFEGIVLFIILWTIRKKAPWPGYLSGLYLIGYGTVRFFIEFFR EPDAQLGFVFLNFSMGQVLCFLMIAAGIGILVWSKQRAENADVMMGGKR
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links

KEGG: cte:CT1090

STRING: 194439.CT1090

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chlorobium tepidum Lgt and what is its primary function?

Prolipoprotein diacylglyceryl transferase (Lgt) in Chlorobium tepidum is an enzyme that catalyzes the first irreversible step in bacterial lipoprotein biogenesis. Specifically, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of a conserved cysteine residue in preprolipoproteins via a thioether bond . This modification is crucial for proper membrane anchoring of lipoproteins, which play essential roles in various cellular processes in C. tepidum, a green sulfur bacterium that performs anoxygenic photosynthesis using the reductive tricarboxylic acid cycle .

What are the optimal conditions for recombinant expression of C. tepidum Lgt?

For optimal recombinant expression of C. tepidum Lgt, several factors must be considered based on the enzyme's membrane-associated nature and the organism's growth requirements. While specific data for C. tepidum Lgt is limited in the search results, similar membrane proteins have been successfully expressed using the following approaches:

Expression ParameterRecommended ConditionRationale
Expression systemE. coli C41(DE3) or C43(DE3)Better tolerance for membrane protein expression
Growth temperature20-25°CReduces inclusion body formation and improves folding
Induction0.1-0.5 mM IPTG, low inductionPrevents toxicity from membrane protein overexpression
Media supplements0.5-1% glucoseReduces basal expression before induction
Membrane extractionDetergent screening (DDM, LDAO, etc.)Optimization required for membrane protein solubilization

The recombinant enzyme can be assayed by measuring glycerol phosphate release, which occurs as a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate .

What are the challenges in purifying functional recombinant C. tepidum Lgt?

Purifying functional C. tepidum Lgt presents several technical challenges due to its properties as an integral membrane protein. Based on studies of Lgt from other bacterial species:

  • Membrane extraction requires careful optimization of detergent type and concentration to maintain enzymatic activity while ensuring efficient solubilization.

  • The enzyme may require specific phospholipids to maintain structural integrity and activity during purification.

  • As a thermophilic protein (C. tepidum is a thermophilic bacterium originally isolated from high-sulfide hot springs), the recombinant enzyme may have different stability characteristics compared to mesophilic counterparts .

  • Purification must be conducted under conditions that preserve the thioether bond-forming capability of the enzyme, potentially requiring reducing conditions to prevent oxidation of critical cysteine residues.

  • Activity assays should be designed to detect the formation of both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) as by-products of the enzymatic reaction, depending on the phosphatidylglycerol substrate used .

How can the enzymatic activity of recombinant C. tepidum Lgt be accurately measured?

The enzymatic activity of recombinant C. tepidum Lgt can be measured through several complementary approaches:

  • Glycerol phosphate release assay: This method detects the release of glycerol phosphate (either G1P or G3P) as a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate. The detection can be coupled to a luciferase reaction for quantitative measurement .

  • Peptide substrate modification: Using synthetic peptides derived from known lipoproteins (similar to the Pal-IAAC peptide used in E. coli studies), where the terminal cysteine serves as the modification site. A negative control using a peptide with cysteine mutated to alanine (e.g., Pal-IAA) helps confirm specificity .

  • Mass spectrometry analysis: To directly detect the addition of the diacylglyceryl moiety to the peptide substrate, showing the expected mass increase after the enzymatic reaction.

The specific activity can be calculated as the amount of product formed per unit time per unit of enzyme, typically expressed as μmol/min/mg of protein.

What are the substrate specificities of C. tepidum Lgt compared to other bacterial Lgt enzymes?

While the search results don't provide specific data on C. tepidum Lgt substrate specificity, insights can be drawn from studies of Lgt in other bacteria:

PropertyC. tepidum Lgt (predicted)E. coli Lgt (known)
Lipobox recognition[LVI][ASTVI][GAS]C motif[LVI][ASTVI][GAS]C motif
Phospholipid preferenceLikely phosphatidylglycerolPhosphatidylglycerol
Cofactor requirementNADPH (potential, based on other redox enzymes in C. tepidum)None reported
Temperature optimumLikely higher (35-45°C)30-37°C
pH optimumLikely neutral to slightly alkalineNeutral

C. tepidum Lgt likely recognizes the same consensus lipobox sequence found in other bacteria, but may have adaptations related to the unique membrane composition of this green sulfur bacterium . The enzyme's ability to process diverse lipoprotein precursors would be an important aspect of its functionality in the context of C. tepidum's anoxygenic photosynthetic metabolism .

What structural features distinguish C. tepidum Lgt from other bacterial Lgt proteins?

Although specific structural data for C. tepidum Lgt is not provided in the search results, several distinguishing features can be inferred based on the organism's unique physiology and comparison with other bacterial Lgt proteins:

  • As C. tepidum is a thermophilic organism originally isolated from high-sulfide hot springs, its Lgt likely contains structural adaptations for thermal stability, such as increased hydrophobic packing, additional salt bridges, or disulfide bonds compared to mesophilic homologs .

  • The binding pocket for phosphatidylglycerol may be adapted to accommodate the unique membrane phospholipid composition of C. tepidum, which differs from that of proteobacteria like E. coli.

  • C. tepidum performs anoxygenic photosynthesis, potentially requiring specialized interfaces between Lgt and photosynthetic apparatus components, as numerous lipoproteins are involved in photosynthetic processes .

  • Based on studies of other Lgt proteins, the enzyme likely contains multiple transmembrane domains with conserved catalytic residues positioned to coordinate the thioether bond formation between the diacylglyceryl moiety and the cysteine residue of the target lipoprotein.

How do mutations in conserved residues affect C. tepidum Lgt activity?

While specific mutagenesis studies on C. tepidum Lgt are not described in the search results, the impact of conserved residue mutations can be predicted based on general principles of enzyme function and studies of Lgt in other bacteria:

  • Mutations in residues involved in phosphatidylglycerol binding would likely reduce substrate affinity, resulting in decreased enzymatic activity as measured by glycerol phosphate release .

  • Alterations to residues coordinating the thiol group of the target cysteine would disrupt the catalytic mechanism, potentially abolishing activity completely.

  • Changes to transmembrane domains could affect proper membrane integration and orientation of the enzyme, indirectly impacting activity.

  • As seen with inhibitor studies in other bacteria, modifications that disrupt the enzyme's active site without completely abolishing function might result in phenotypes similar to those observed in Lgt depletion conditions, including outer membrane permeabilization and increased antibiotic sensitivity .

What is the role of Lgt in C. tepidum's lipoprotein processing pathway?

In C. tepidum, as in other Gram-negative bacteria, Lgt catalyzes the first committed step in lipoprotein maturation, which follows a sequential pathway:

  • Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the conserved cysteine in the lipobox of preprolipoproteins that have been translocated across the inner membrane via the Sec or Tat pathways .

  • Following Lgt-mediated diacylglyceryl modification, the prolipoprotein signal peptidase (LspA) cleaves the signal peptide at the N-terminal side of the modified cysteine .

  • In Gram-negative bacteria like C. tepidum, lipoprotein N-acyl transferase (Lnt) then adds a third acyl chain to the amino group of the N-terminal cysteine via an amide linkage .

  • Mature triacylated lipoproteins destined for the outer membrane are extracted and transported by the Lol system .

This pathway is essential for the proper localization and function of numerous lipoproteins involved in C. tepidum's unique photosynthetic metabolism and sulfur oxidation processes .

How does Lgt function relate to C. tepidum's adaptation to its ecological niche?

C. tepidum's Lgt plays a crucial role in adapting this organism to its unique ecological niche as a thermophilic, anoxygenic photosynthetic bacterium:

  • C. tepidum was originally isolated from high-sulfide hot springs, and proper lipoprotein processing by Lgt is likely essential for maintaining membrane integrity under these extreme conditions .

  • The organism performs anoxygenic photosynthesis using the reductive tricarboxylic acid cycle, and many components of this complex metabolic machinery require correctly processed lipoproteins .

  • C. tepidum shows remarkable adaptability to different electron donors, including thiosulfate and sulfide, with transcriptional responses that suggest involvement of membrane-associated proteins in these metabolic shifts .

  • The transcriptome analysis of C. tepidum revealed that sulfide addition to thiosulfate-grown cultures induces significant changes in gene expression, including genes potentially encoding lipoproteins involved in sulfur metabolism .

  • Proper lipoprotein processing is likely essential for C. tepidum's ability to synthesize three types of (bacterio)chlorophyll—BChl a(P), Chl a(PD), and BChl c(F)—which are critical for its photosynthetic lifestyle .

How can recombinant C. tepidum Lgt be used to screen for novel antimicrobial compounds?

Recombinant C. tepidum Lgt can serve as a valuable tool for antimicrobial discovery through several approaches:

  • Biochemical screening platform: Using the established glycerol phosphate release assay, large compound libraries can be screened for molecules that inhibit Lgt activity in vitro . The assay can be optimized for high-throughput screening by coupling to luciferase-based detection systems.

  • Comparative inhibition studies: As Lgt is essential in proteobacteria , comparing inhibitor profiles between C. tepidum Lgt and pathogen-derived Lgt enzymes could identify compounds with selective activity against specific bacterial groups.

  • Structure-based drug design: Using structural information from C. tepidum Lgt (once available) in combination with molecular docking approaches to design inhibitors targeting the enzyme's active site.

  • Resistance mechanism prediction: Based on findings that deletion of major outer membrane lipoprotein (lpp) does not rescue growth after Lgt depletion or provide resistance to Lgt inhibitors , compounds targeting C. tepidum Lgt could be evaluated for their potential to overcome common resistance mechanisms.

What techniques are available for studying the interaction between C. tepidum Lgt and its lipoprotein substrates?

Several advanced techniques can be employed to study the interaction between C. tepidum Lgt and its lipoprotein substrates:

  • Site-directed spin labeling coupled with electron paramagnetic resonance (EPR) spectroscopy: This approach can provide information about the conformational changes that occur in both Lgt and its substrates during the catalytic cycle.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics between Lgt and synthetic peptides representing various lipobox sequences found in C. tepidum preprolipoproteins.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify regions of both Lgt and substrate peptides that undergo protection upon complex formation, providing insights into the binding interface.

  • Cross-linking mass spectrometry: Using bifunctional cross-linkers to capture transient interactions between Lgt and its substrates, followed by mass spectrometric identification of the cross-linked residues.

  • Cryo-electron microscopy: For structural characterization of Lgt in complex with substrate peptides, potentially revealing the mechanism of diacylglyceryl transfer at near-atomic resolution.

What are common problems encountered when working with recombinant C. tepidum Lgt and how can they be addressed?

Researchers working with recombinant C. tepidum Lgt may encounter several challenges:

ProblemLikely CauseRecommended Solution
Low expression yieldToxicity due to membrane protein overexpressionUse specialized E. coli strains (C41/C43), lower induction temperature (16-20°C), and reduce inducer concentration
Protein aggregationImproper folding or detergent incompatibilityScreen multiple detergents; add glycerol (10-20%) to buffers; consider fusion tags that enhance solubility
Loss of activity during purificationRemoval of essential lipids or cofactorsSupplement purification buffers with phospholipids; avoid harsh detergents; include reducing agents
Inconsistent activity assay resultsVariation in substrate quality or assay conditionsStandardize phosphatidylglycerol preparation; control temperature closely; include appropriate controls
Substrate specificity issuesDifferences between C. tepidum and model system lipobox sequencesDesign peptide substrates based specifically on C. tepidum lipoprotein sequences identified through genomic analysis

Additionally, working with this thermophilic enzyme may require adaptation of standard protocols to account for its potentially higher temperature optimum and unique stability characteristics .

How can the expression system for C. tepidum Lgt be optimized for structural studies?

Optimizing recombinant C. tepidum Lgt expression for structural studies requires specialized approaches:

  • Expression construct design:

    • Use codon optimization for the expression host

    • Consider fusion partners like GFP or MBP that can improve folding and provide a convenient purification handle

    • Include a cleavable tag for tag removal prior to crystallization attempts

    • Consider truncation constructs that remove flexible regions while maintaining core catalytic domains

  • Host selection:

    • For X-ray crystallography: Specialized E. coli strains for membrane protein expression

    • For NMR studies: Capability for isotope labeling (15N, 13C)

    • For cryo-EM: High-yield expression systems to generate sufficient quantities of pure protein

  • Stabilization strategies:

    • Screen detergent-lipid combinations systematically

    • Consider nanodiscs or amphipols as alternatives to detergent micelles

    • Utilize thermostability assays (e.g., differential scanning fluorimetry) to identify optimal buffer conditions

    • Test the addition of substrate analogues or inhibitors that may stabilize a specific conformation

  • Purification optimization:

    • Implement multiple orthogonal chromatography steps

    • Consider on-column detergent exchange

    • Utilize size exclusion chromatography as a final polishing step and to confirm monodispersity

These approaches should be evaluated systematically, with protein quality assessed at each step through activity assays, biophysical characterization, and pilot structural studies .

What are promising areas for future research on C. tepidum Lgt?

Several promising research directions for C. tepidum Lgt include:

  • Comparative genomics and evolution: Investigating how Lgt function has evolved in green sulfur bacteria compared to other bacterial phyla, particularly in relation to C. tepidum's unique ecological niche and metabolic capabilities .

  • Integration with photosynthetic pathways: Exploring potential connections between lipoprotein processing and C. tepidum's anoxygenic photosynthetic machinery, possibly revealing novel lipoproteins involved in photosynthesis .

  • Response to environmental conditions: Expanding on transcriptomic studies to understand how Lgt activity and lipoprotein profiles change in response to varying electron donors, light conditions, and sulfur compounds .

  • Structural biology: Determining the three-dimensional structure of C. tepidum Lgt to understand its mechanism and substrate specificity at the atomic level.

  • Synthetic biology applications: Utilizing C. tepidum Lgt in engineered pathways for the production of modified lipoproteins with novel properties or applications.

  • Inhibitor development: Building on the success with identifying Lgt inhibitors in other bacterial systems to develop compounds targeting the unique properties of C. tepidum Lgt .

How might C. tepidum Lgt research contribute to understanding extremophile adaptation mechanisms?

Research on C. tepidum Lgt has significant potential to advance our understanding of extremophile adaptation mechanisms:

  • As C. tepidum was originally isolated from high-sulfide hot springs, studying its Lgt provides insights into membrane protein adaptations that enable survival in thermophilic, sulfide-rich environments .

  • The essential nature of Lgt in bacterial envelope biogenesis makes it an excellent model for understanding how fundamental cellular processes are maintained under extreme conditions .

  • Comparing the biochemical properties of C. tepidum Lgt with homologs from mesophilic bacteria could reveal specific adaptations that confer thermal stability or tolerance to high sulfide concentrations.

  • Investigating the lipoproteins processed by C. tepidum Lgt could identify specialized proteins involved in protecting cellular machinery from thermal stress or oxidative damage from sulfur metabolism.

  • The integration of Lgt function with C. tepidum's complex transcriptional response to changing environmental conditions provides a model for studying how extremophiles regulate membrane composition and function to maintain homeostasis under challenging conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.