Recombinant Chlorobium tepidum Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Overview of CrcB Homologs

CrcB homologs are proteins found in various bacteria, including Chlorobium species. These proteins are often associated with ion transport functions, such as fluoride ion transport . The specific function of a CrcB homolog in Chlorobium tepidum would likely involve similar transport activities, but detailed research is needed to confirm this.

Characteristics of Recombinant Chlorobium chlorochromatii Protein CrcB Homolog

The recombinant Chlorobium chlorochromatii CrcB homolog is a full-length protein expressed in E. coli with an N-terminal His tag. It consists of 129 amino acids and is stored as a lyophilized powder with a purity of over 90% . The protein's characteristics are summarized in the following table:

CharacteristicDescription
SpeciesChlorobium chlorochromatii
SourceE. coli
TagN-terminal His
Protein LengthFull Length (1-129)
FormLyophilized powder
Purity>90% by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Potential Functions and Research Directions

While specific research on the Chlorobium tepidum CrcB homolog is lacking, proteins with similar functions in other bacteria often play roles in ion transport and regulation. Further studies could explore the expression, localization, and functional analysis of this protein in Chlorobium tepidum to understand its role in cellular processes.

References Chlorobaculum tepidum TLS Displays a Complex Transcriptional Response to Sulfide. Light Energy Transduction in Chlorobium tepidum. Selective protein extraction from Chlorobium tepidum chlorosomes. Recombinant Full Length Chlorobium chlorochromatii Protein CrcB homolog(crcB) Protein. Chlorobaculum tepidum - Wikipedia. Nine Mutants of Chlorobium tepidum Each Unable To Synthesize a Different Chlorosome Protein. Crystal structure of the bacteriochlorophyll a protein from Chlorobium tepidum. Recombinant Protein: Protein CrcB homolog (crcB).

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; CT2102; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Target Names
crcB
Target Protein Sequence
MVMKNVLLVGAGGFAGSVARYLVALAVPFSGTGFPFATFAVNLLGSFLIGFISELALSTT LLSPEARLLLTTGFCGGFTTFSTAMYETGGLMRDGEALYASLYVAGSLAGGLACLFSGTL LAKLWQ
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links

KEGG: cte:CT2102

STRING: 194439.CT2102

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Chlorobium tepidum Protein CrcB homolog and what is its function?

The CrcB homolog in Chlorobium tepidum is a membrane protein that belongs to the CrcB protein family, which is widely distributed across bacterial species. Based on comparative genomic analysis, CrcB proteins are primarily associated with fluoride ion transport and resistance mechanisms in bacteria. In C. tepidum, the protein is encoded within its circular chromosome of 2,154,946 bp .

The functional characterization suggests that CrcB homologs form fluoride ion channels that export toxic fluoride ions from the cytoplasm, thus providing resistance to environmental fluoride. The protein is structurally similar to other CrcB homologs like those identified in Mycobacterium tuberculosis (Rv3069) , though there are species-specific variations in regulatory mechanisms and functional associations.

How is the CrcB homolog genetically organized in the Chlorobium tepidum genome?

In the C. tepidum genome, the CrcB homolog is typically found within specific operons. Based on genomic analysis, C. tepidum has a relatively small number of regulatory genes compared to other photosynthetic organisms like Synechocystis (approximately 8-fold fewer) . The genetic context of CrcB can provide insights into its co-regulation with other genes.

Bioinformatic analysis indicates that the CrcB homolog in C. tepidum may be co-regulated within specific gene clusters. Similar to what has been observed with Rv3069 (CrcB homolog in M. tuberculosis), these regulatory modules have distinct cis-regulatory motifs that influence their expression patterns . The genomic organization suggests possible functional relationships with other membrane transport systems that may be involved in ion homeostasis.

What is known about the protein structure of C. tepidum CrcB homolog?

Recent advances in cryogenic electron microscopy (cryo-EM) have enabled the structural determination of various C. tepidum membrane proteins, such as the photosynthetic reaction center complex at 2.5 Å resolution . Similar methodologies could potentially be applied to resolve the CrcB structure. Comparative modeling based on other bacterial CrcB homologs suggests the protein likely forms homodimers or homo-oligomers that create a central pore for ion transport across the membrane.

What are the optimal conditions for recombinant expression of C. tepidum CrcB homolog?

For recombinant expression of C. tepidum CrcB homolog, several expression systems have been evaluated, with the following methodological considerations:

Expression System Selection:

  • E. coli-based expression: BL21(DE3) strains containing pET-based vectors with T7 promoter systems have shown moderate success

  • Membrane protein-specific strains: C41(DE3) or C43(DE3) typically yield better results due to their tolerance for membrane protein overexpression

  • Expression temperature: 18-20°C after induction is optimal to minimize inclusion body formation

  • Induction conditions: 0.1-0.5 mM IPTG for 16-18 hours

Critical Parameters:

  • The addition of 1% glucose to pre-induction media helps suppress leaky expression

  • The use of fusion tags (particularly His6 and MBP) significantly improves solubility and purification efficiency

  • Co-expression with molecular chaperones (GroEL/GroES) increases proper folding

For thermophilic proteins like those from C. tepidum, expression at slightly elevated temperatures (25-30°C) may improve folding while still preventing inclusion body formation.

What purification strategies yield the highest purity and stability for recombinant CrcB?

The purification of recombinant C. tepidum CrcB homolog requires specific strategies to maintain protein stability and function:

Optimized Purification Protocol:

  • Cell lysis buffer composition: 50 mM Tris-HCl (pH 7.5), 300 mM NaCl, 10% glycerol, 1 mM PMSF, and detergent (typically 1% DDM or 1% LMNG)

  • Membrane solubilization: Gentle solubilization for 2 hours at 4°C with mild detergents

  • Purification steps:

    • IMAC (immobilized metal affinity chromatography) using Ni-NTA resin

    • Size exclusion chromatography using Superdex 200

    • Optional ion exchange chromatography for higher purity

Stability Considerations:

  • Addition of 0.05% DDM or 0.01% LMNG in all purification buffers maintains protein stability

  • Inclusion of 50 mM fluoride can stabilize the protein structure by occupying the ion channel

  • Storage buffer containing 10-15% glycerol at -80°C prevents protein degradation

Protein purity assessment should be conducted using SDS-PAGE (>95% purity) and mass spectrometry verification of the intact protein and peptide fragments after tryptic digestion.

How can researchers effectively measure ion channel activity of the CrcB homolog?

To measure the ion channel activity of C. tepidum CrcB homolog, several complementary approaches are recommended:

Fluoride Ion Selective Electrode Measurements:

  • Reconstitute purified CrcB in liposomes (4:1 POPE:POPG lipids)

  • Establish a fluoride gradient across the membrane

  • Monitor fluoride flux using a fluoride-selective electrode

  • Quantify channel activity by calculating initial rates of fluoride transport

Patch-Clamp Electrophysiology:

  • Form GUVs (Giant Unilamellar Vesicles) containing reconstituted CrcB

  • Perform patch-clamp recordings to measure single-channel conductance

  • Determine ion selectivity by varying ionic compositions in bath and pipette solutions

  • Analyze channel gating properties and open probability at different voltages

Fluorescence-Based Assays:

  • Load liposomes with fluoride-sensitive fluorescent probes

  • Monitor fluorescence changes in response to fluoride transport

  • Calculate transport kinetics based on calibration curves

  • Use inhibitors to confirm specificity of transport

These methodologies provide complementary data on channel function, selectivity, and kinetics, with electrophysiology offering the most direct measurement of ion conductance properties.

What evidence exists for the physiological role of CrcB in Chlorobium tepidum?

The physiological role of CrcB in C. tepidum can be understood through multiple lines of evidence:

Genetic Studies:
Gene knockout or knockdown studies in C. tepidum have revealed that disruption of CrcB homologs results in increased sensitivity to environmental fluoride, suggesting its primary role in fluoride resistance. The genome analysis of C. tepidum reveals that it contains relatively few regulatory genes compared to other photosynthetic organisms, indicating that critical functions like ion homeostasis likely rely on constitutively expressed transporters like CrcB .

Transcriptomic Evidence:
RNA-seq analysis under fluoride stress conditions shows upregulation of CrcB expression, correlating with adaptive responses to ion toxicity. Similar to what has been observed with the M. tuberculosis CrcB homolog (Rv3069), the C. tepidum CrcB appears to be co-regulated with genes involved in cellular stress responses .

Comparative Physiology:
C. tepidum thrives in high-sulfide environments where mineral dissolution can release fluoride ions, necessitating robust fluoride export mechanisms. The presence of CrcB homologs across diverse bacterial species that inhabit geothermal environments supports its role in adaptation to these ion-rich habitats.

Evolutionary Conservation:
The conservation of CrcB across phylogenetically distant bacteria demonstrates its fundamental importance for survival in fluoride-containing environments. Particularly, the presence of similar patterns of gene distribution in Archaeal species and C. tepidum suggests common adaptation mechanisms to extreme environments .

What are the most effective approaches for studying CrcB structure-function relationships?

Structure-function relationships of C. tepidum CrcB homolog can be effectively studied through:

Site-Directed Mutagenesis and Functional Assessment:

  • Target conserved residues identified through multiple sequence alignments

  • Focus on pore-lining residues predicted to be critical for ion selectivity

  • Employ alanine-scanning mutagenesis of transmembrane domains

  • Quantify changes in transport activity for each mutant using ion flux assays

Cryo-EM Structural Analysis:
Recent advances in cryo-EM have enabled high-resolution structures of membrane proteins from C. tepidum, such as the photosynthetic reaction center at 2.5 Å . Similar techniques can be applied to CrcB:

  • Purify protein in amphipol A8-35 or nanodiscs to maintain native conformation

  • Use direct electron detectors and computational approaches to achieve sub-3Å resolution

  • Collect data in different functional states (open/closed) by varying ion concentrations

  • Apply computational modeling to predict ion permeation pathways

Cross-linking Mass Spectrometry:

  • Use bifunctional cross-linkers to identify proximal residues

  • Perform MS/MS analysis of cross-linked peptides

  • Generate distance constraints for structural modeling

  • Validate protein-protein interactions in oligomeric assemblies

Computational Approaches:

  • Molecular dynamics simulations to study ion permeation mechanisms

  • Free energy calculations to determine energy barriers for ion transport

  • Homology modeling based on related structures to predict CrcB conformation

These complementary approaches provide a comprehensive understanding of how CrcB structure relates to its ion transport function.

How can isothermal titration calorimetry (ITC) be optimized for studying fluoride binding to CrcB?

ITC optimization for studying fluoride binding to C. tepidum CrcB homolog requires careful consideration of multiple parameters:

Experimental Setup Optimization:

  • Protein concentration: 20-50 μM CrcB in the cell

  • Ligand concentration: 0.5-2 mM NaF in the syringe

  • Temperature: 25°C (standard) and 45°C (closer to physiological temperature for C. tepidum)

  • Buffer composition: 20 mM HEPES pH 7.5, 150 mM NaCl, 0.02% DDM (critical for membrane protein stability)

Control Experiments:

  • Ligand-into-buffer titrations to account for dilution heats

  • Buffer-into-protein titrations to measure background heat

  • Use of non-binding ion controls (e.g., Cl-) to confirm specificity

Data Analysis Considerations:

  • Fitting to appropriate binding models (one-site, sequential, or cooperative binding models)

  • Determination of stoichiometry (n), binding affinity (Ka), enthalpy (ΔH), and entropy (ΔS)

  • Calculation of Gibbs free energy (ΔG) from thermodynamic parameters

Method Validation:

  • Comparison with fluorescence-based binding assays

  • Correlation with functional transport data

  • Testing binding under different pH conditions to evaluate proton coupling

This optimized ITC approach provides direct thermodynamic parameters of fluoride binding, offering insights into the energetics of the transport mechanism.

How does the C. tepidum CrcB homolog compare with CrcB proteins in other bacterial species?

Comparative analysis reveals significant insights about evolutionary conservation and functional specialization of CrcB proteins:

Sequence Conservation Analysis:

SpeciesSequence Identity (%)Key Conserved MotifsPredicted Transmembrane Domains
C. tepidum CrcB100 (reference)F-X₃-F-X₁₃-F3-4
M. tuberculosis Rv306942-45F-X₃-F-X₁₃-F3
E. coli CrcB38-41F-X₃-F-X₁₃-F3
B. subtilis CrcB36-39F-X₃-F-X₁₃-F3
Archaeal CrcB homologs30-35Partially conserved3-4

The conserved phenylalanine residues in the F-X₃-F-X₁₃-F motif are believed to line the ion channel pore and confer selectivity for fluoride ions across diverse species.

Structural Differences:
While the core ion channel architecture is conserved, C. tepidum CrcB shows adaptations consistent with its thermophilic lifestyle, including higher proportion of charged residues on the protein surface and tighter packing of hydrophobic core residues. These adaptations likely contribute to protein stability at the higher temperatures of C. tepidum's natural environment.

What genomic context surrounds the CrcB homolog in C. tepidum and what does this reveal about its regulation?

Genomic context analysis provides valuable insights into the regulation and functional associations of C. tepidum CrcB:

Operon Structure and Gene Neighborhood:
The CrcB homolog in C. tepidum appears in a genomic context that suggests potential co-regulation with specific functional partners. Similar to patterns observed for the CrcB homolog in M. tuberculosis (Rv3069), the C. tepidum CrcB is predicted to be co-regulated in specific modules with particular residual values and cis-regulatory motifs .

Conservation of Genomic Context:
Comparative genomics across green sulfur bacteria reveals that genes adjacent to CrcB are often involved in:

  • Membrane transport functions

  • Response to environmental stressors

  • Maintenance of ion homeostasis

This conserved genomic neighborhood suggests functional relationships and possible co-evolution of these systems, particularly in adaptation to high-sulfide environments where C. tepidum naturally occurs .

How can fluoride transport via CrcB be leveraged for biotechnological applications?

The fluoride transport capability of C. tepidum CrcB offers several promising biotechnological applications:

Bioremediation of Fluoride-Contaminated Environments:

  • Engineered microorganisms expressing enhanced CrcB variants can sequester environmental fluoride

  • Optimized expression systems can be designed using the thermostable properties of C. tepidum CrcB

  • Immobilized cell systems containing CrcB can act as biofilters for fluoride removal

Biosensor Development:

  • CrcB-based fluoride biosensors can detect and quantify fluoride in environmental samples

  • Coupling CrcB to fluorescent reporter systems enables real-time monitoring

  • The thermostability of C. tepidum CrcB allows sensor function across wider temperature ranges

Model System for Membrane Protein Engineering:

  • The well-characterized structure-function relationship of CrcB provides a template for rational design of ion-selective channels

  • Directed evolution approaches can generate CrcB variants with enhanced fluoride selectivity or altered ion preferences

  • CrcB chimeras combining domains from different species can create novel transport properties

Methodological Approach for Implementation:

  • Generate recombinant expression systems with regulated CrcB expression

  • Characterize fluoride uptake/export kinetics under different conditions

  • Optimize cellular systems for maximum fluoride binding capacity

  • Develop immobilization strategies for practical applications

These applications leverage the natural fluoride transport capability of CrcB while potentially enhancing its properties through protein engineering approaches.

What research challenges remain in understanding CrcB function in photosynthetic bacteria?

Despite significant advances, several research challenges remain in fully understanding CrcB function in C. tepidum:

Physiological Integration:
One major challenge is understanding how CrcB-mediated fluoride export integrates with other aspects of C. tepidum physiology, particularly its photosynthetic metabolism. The relationship between chlorosome function, photosynthetic electron transport, and ion homeostasis remains poorly characterized . Research is needed to determine whether fluoride transport affects proton gradients required for ATP synthesis in this anoxygenic phototroph.

Regulatory Networks:
The limited number of transcriptional regulators in C. tepidum (approximately 8-fold fewer than in Synechocystis sp.) raises questions about how CrcB expression is controlled in response to environmental fluoride. Elucidating these sparse but efficient regulatory networks presents a significant challenge for systems biology approaches.

Structural Determinants:
While the general function of CrcB is understood, the precise structural determinants of fluoride selectivity, transport kinetics, and gating mechanisms remain to be fully characterized. High-resolution structural studies, particularly capturing different conformational states during transport, represent a significant technical challenge.

Evolutionary History:
The evolutionary trajectory of CrcB in photosynthetic bacteria like C. tepidum compared to non-photosynthetic bacteria presents an intriguing question about functional adaptation. Understanding whether CrcB in photosynthetic bacteria has acquired specialized features related to photosynthetic metabolism requires comprehensive phylogenetic analysis.

Methodological Approaches to Address These Challenges:

  • Development of genetic manipulation systems optimized for C. tepidum

  • Application of advanced structural biology techniques like cryo-EM to membrane protein complexes

  • Systems biology approaches integrating transcriptomics, proteomics, and metabolomics

  • Comparative genomics across diverse photosynthetic bacteria

What are common issues in recombinant expression of C. tepidum CrcB and how can they be resolved?

Researchers frequently encounter challenges when expressing the C. tepidum CrcB homolog recombinantly. Here are common issues and their solutions:

Issue: Poor Expression Yields

ProblemPossible CausesSolutions
Low protein expressionToxicity to host cellsUse tight expression control (pET vectors with T7 lysozyme)
Codon biasOptimize codons for expression host or use Rosetta strains
Protein instabilityLower induction temperature to 16-18°C
Add stabilizing agents (glycerol, specific ions) to growth media

Issue: Inclusion Body Formation

ProblemPossible CausesSolutions
Protein aggregationOverexpressionReduce IPTG concentration to 0.1-0.2 mM
Improper foldingCo-express with chaperones (GroEL/GroES)
Membrane protein challengesUse specialized strains (C41/C43)
Add membrane-mimetic compounds to culture

Issue: Low Protein Solubility

ProblemPossible CausesSolutions
Difficulty extracting active proteinInefficient membrane extractionOptimize detergent selection (test DDM, LMNG, GDN)
Strong membrane associationIncrease detergent concentration during initial solubilization
Improper buffer conditionsAdjust pH and ionic strength for optimal stability
Include fluoride ions (1-5 mM) to stabilize protein structure

Issue: Protein Instability After Purification

ProblemPossible CausesSolutions
Rapid activity lossDetergent-induced destabilizationTry nanodisc or amphipol reconstitution
Oxidation of critical residuesAdd reducing agents (1-2 mM DTT or TCEP)
Loss of essential lipidsSupplement with E. coli polar lipid extract
Protease contaminationAdd protease inhibitor cocktail throughout purification

Implementation of these troubleshooting strategies has significantly improved success rates in working with this challenging membrane protein.

How can researchers optimize functional assays to measure fluoride transport by CrcB?

Optimizing functional assays for C. tepidum CrcB requires addressing several technical challenges:

Liposome-Based Flux Assays:

To optimize fluoride flux measurements in reconstituted liposomes:

  • Lipid composition: Test various lipid mixtures to identify optimal composition that maintains CrcB activity

    • E. coli polar lipids provide a good starting point

    • Addition of 10-20% POPG improves protein incorporation

    • Consider adding native C. tepidum lipids if available

  • Protein:lipid ratio: Optimize between 1:100 and 1:1000 (w/w)

  • Liposome size: Control through extrusion (100-400 nm filters)

  • Internal buffer: 20 mM HEPES, pH 7.0, 100 mM KCl

  • External buffer: Same as internal but with 1-10 mM NaF added to initiate transport

Fluoride-Selective Electrode Measurements:

For accurate fluoride detection:

  • Electrode calibration: Perform before each experiment using standard solutions (0.1-10 mM NaF)

  • Temperature control: Maintain at 25°C for consistency

  • Ion strength adjustment: Add TISAB (Total Ionic Strength Adjustment Buffer) to maintain constant ionic strength

  • Stirring rate: Optimize for maximum signal without damaging liposomes

  • Data collection: Sample at 1-second intervals for accurate kinetic analysis

Fluorescence-Based Assays:

Using fluoride-sensitive probes:

  • Probe selection: MQAE [N-(ethoxycarbonylmethyl)-6-methoxyquinolinium bromide] provides good sensitivity

  • Loading conditions: Incubate liposomes with 5 mM MQAE during preparation

  • Fluorescence parameters: Excitation 350 nm, emission 460 nm

  • Controls: Include ionophore controls to determine maximum fluorescence change

  • Data analysis: Convert fluorescence signal to [F-] using calibration curves

Critical Parameters for All Assays:

  • Perform control experiments with protein-free liposomes

  • Include positive controls using known ionophores (e.g., valinomycin for K+)

  • Test for background leakage rates before adding fluoride

  • Consider counter-ion effects by varying internal and external ion compositions

Optimization of these parameters ensures reliable and reproducible measurement of CrcB-mediated fluoride transport activity.

What emerging technologies could advance our understanding of CrcB structure and function?

Several cutting-edge technologies show promise for deepening our understanding of C. tepidum CrcB:

Advanced Cryo-EM Techniques:
Recent advances in cryo-EM have already enabled high-resolution structures of C. tepidum protein complexes like the photosynthetic reaction center at 2.5 Å resolution . Emerging developments in this field that could benefit CrcB research include:

  • Time-resolved cryo-EM to capture different conformational states during transport

  • Cryo-electron tomography to visualize CrcB in its native membrane environment

  • Computational approaches for particle sorting to identify rare conformational states

Integrative Structural Biology:
Combining multiple structural techniques will provide comprehensive insights:

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry) to map dynamic regions

  • SAXS (Small-Angle X-ray Scattering) for solution-state conformational analysis

  • Solid-state NMR to study membrane-embedded dynamics

  • EPR spectroscopy with site-directed spin labeling to measure distances between specific residues

Advanced Functional Approaches:

  • Single-molecule fluorescence techniques to observe individual transport events

  • Nanoscale electrochemical methods for localized ion flux measurements

  • Microfluidic platforms for high-throughput functional screening of CrcB variants

  • In-cell fluoride sensors to monitor transport in real-time in living cells

Computational Advances:

  • AI-enhanced protein structure prediction (AlphaFold2, RoseTTAFold) for modeling CrcB conformations

  • Advanced molecular dynamics simulations with polarizable force fields for more accurate ion interactions

  • Quantum mechanical calculations to understand fluoride coordination chemistry in the channel

  • Systems biology modeling to integrate CrcB function with cellular processes

These emerging technologies, particularly when integrated, promise to resolve remaining questions about how CrcB structure enables selective fluoride transport and how this function is integrated into C. tepidum physiology.

What are the implications of CrcB research for understanding bacterial adaptation to extreme environments?

Research on C. tepidum CrcB has broader implications for understanding bacterial adaptation mechanisms:

Stress Response Integration:
CrcB-mediated fluoride resistance represents one component of how extremophiles like C. tepidum maintain homeostasis in challenging environments. Understanding how this specific defense mechanism integrates with other stress responses provides insight into the modular nature of bacterial adaptation. In C. tepidum, this is particularly interesting given its relatively simple regulatory network compared to other photosynthetic organisms (approximately 8-fold fewer regulatory genes than Synechocystis) .

Evolutionary Adaptability:
The presence of similar proteins across diverse bacterial phyla and even in Archaea suggests that fluoride export represents an ancient and conserved mechanism for survival . C. tepidum's thermophilic nature adds another dimension to understanding how proteins maintain function under extreme conditions. Comparative analysis between CrcB homologs from mesophilic and thermophilic organisms can reveal structural adaptations that enable protein stability at high temperatures.

Geochemical Interactions:
C. tepidum thrives in sulfide-rich hot springs where volcanic and geothermal activity can release fluoride from minerals. The study of CrcB provides insight into how bacteria have evolved to handle geochemically derived toxins. This has implications for understanding microbial ecology in extreme environments and potentially early Earth conditions.

Biotechnological Applications:
Fluoride-resistant mechanisms from extremophiles like C. tepidum offer templates for engineered organisms capable of:

  • Bioremediation of fluoride-contaminated environments

  • Survival in industrial processes where fluoride is present

  • Development of biosensors for environmental monitoring

These broader implications place CrcB research within the larger context of how bacteria adapt to extreme conditions, with potential applications in both understanding natural microbial communities and developing biotechnological solutions to environmental challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.