Recombinant Chlorocebus aethiops C-C chemokine receptor type 3 (CCR3)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Chlorocebus aethiops C-C chemokine receptor type 3 (CCR3) refers to the artificially produced form of the CCR3 receptor derived from the African green monkey (Chlorocebus aethiops). CCR3 is a G-protein-coupled receptor (GPCR) that binds C-C chemokines, including eotaxin (CCL11), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5) . It plays a critical role in immune cell migration, allergy pathogenesis, and viral entry mechanisms, particularly as a co-receptor for HIV-1 and simian immunodeficiency viruses (SIV) .

Immune Cell Recruitment

CCR3 mediates chemotaxis of eosinophils, basophils, and Th2 cells in allergic inflammation (e.g., asthma, atopic dermatitis) . For example:

  • Eosinophil Migration: CCR3 binds eotaxins, driving eosinophil accumulation in airways .

  • Basophil Activation: CCR3 triggers histamine release in response to CCL11 and MCP-4 .

Viral Entry

CCR3 functions as a co-receptor for viral entry, particularly in non-human primates:

  • HIV-1/SIV: Human CCR3 facilitates HIV-1 entry, while Chlorocebus aethiops CCR3 supports SIV (e.g., SIVagm) infection in African green monkey models .

  • Coreceptor Specificity: Extracellular domains 1–2 or 3–4 of CCR3 determine HIV-1 vs. HIV-2/SIV tropism .

Viral Pathogenesis Studies

Study FocusFindings
SIVagm Coreceptor UsageChlorocebus aethiops CCR3 supports SIVagm entry, unlike human CCR3 .
HIV-1 vs. SIV TropismHuman CCR3 permits HIV-1 entry, while macaque CCR3 restricts it .

Therapeutic Targeting

  • Anti-Inflammatory Agents: CCR3 antagonists (e.g., SB328437) reduce eosinophil recruitment in colitis models .

  • Allergy Treatments: Blocking CCR3 inhibits eotaxin-induced MMP-9 expression in synovial fibroblasts .

Signal Transduction

PathwayOutcome
Gq-PLC-Ca²⁺Triggers eosinophil degranulation and actin polymerization .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CCR3; CMKBR3; C-C chemokine receptor type 3; C-C CKR-3; CC-CKR-3; CCR-3; CCR3; CKR3; CD antigen CD193
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Target Names
Target Protein Sequence
MTTSLYTVETFGPTSYDDDMGLLCEKADVGALIAQFVPPLYSLVFTVGLLGNVVVVMILI KYRRLRIMTNIYLLNLAISDLLFLFTLPFWIHYVREHNWVFSHGMCKVLSGFYHTGLYSE IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLVALPEFIFYGTEELFPE TLCSAIYPQDTVYSWRHFHTLKMTILCLALPLLVMAICYTGIIKTLLKCPSKKKYKAIRL IFVIMAVFFIFWTPYNVAILISTYQSILFGLDCERSKHVDLVVLVTEVIAYSHCCVNPVI YAFVGERFRKYLRHFFHRHVLMHLGRYIPFLPSEKLERTSSVSPSTAEPELCIVF
Uniprot No.

Target Background

Function

Recombinant Chlorocebus aethiops C-C chemokine receptor type 3 (CCR3): A receptor for C-C type chemokines. It binds to eotaxin, MCP-3, MCP-4, and RANTES, subsequently triggering intracellular signaling by increasing calcium ion levels.

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Chlorocebus aethiops CCR3 and how does it compare to human CCR3?

Chlorocebus aethiops (African green monkey) CCR3 is a G protein-coupled receptor belonging to the CC chemokine receptor family. Like human CCR3, it functions as a receptor for C-C type chemokines including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5) . The protein consists of approximately 355 amino acids with a molecular weight of approximately 41 kDa, similar to human CCR3 . While the sequence homology is high between species, researchers should note that minor structural differences may affect ligand binding properties and downstream signaling pathways in comparative studies.

Methodological approach: When conducting comparative analysis between Chlorocebus aethiops and human CCR3, employ sequence alignment software such as BLAST or Clustal Omega to identify conserved domains and species-specific variations. For functional comparisons, design parallel binding assays using the same panel of chemokines to quantify potential differences in affinity and receptor activation.

What are the primary tissue expression patterns of CCR3 in Chlorocebus aethiops?

Based on current research, CCR3 in Chlorocebus aethiops, similar to human CCR3, is highly expressed in eosinophils and basophils . It is also detected in TH1 and TH2 cells and airway epithelial cells . Of particular research interest is CCR3 expression in mast cells, where it has been demonstrated that human mast cells express CCR3 both on their cell surface and intracellularly within secretory granules .

Methodological approach: To characterize tissue-specific expression patterns, implement immunohistochemistry using validated anti-CCR3 antibodies with cross-reactivity to Chlorocebus aethiops CCR3. Alternatively, use RT-qPCR with species-specific primers to quantify mRNA expression across different tissues. Flow cytometry can be employed for cellular localization studies, using saponin permeabilization to detect both surface and intracellular CCR3 pools .

What are the recommended protocols for expression and purification of recombinant Chlorocebus aethiops CCR3?

Several expression systems have been successfully employed for producing recombinant CCR3, including E. coli, HEK293 cells, mammalian cell lines, and cell-free systems . Each system offers distinct advantages depending on your research requirements.

Methodological approach:

  • For structural studies requiring high protein yields, consider E. coli expression systems with appropriate solubilization and refolding protocols

  • For functional studies requiring proper post-translational modifications, HEK293 or other mammalian expression systems are recommended

  • Purification typically involves affinity chromatography using epitope tags (His, FLAG, or Fc tags)

  • Monitor protein purity using SDS-PAGE and Western blotting

  • Validate protein functionality through ligand binding assays using known CCR3 ligands such as eotaxin-1

The choice of expression system should align with your specific research objectives. For instance, studies examining glycosylation patterns would necessitate mammalian expression systems that preserve these modifications.

How can I validate the functionality of purified recombinant Chlorocebus aethiops CCR3?

Functional validation is essential for ensuring that purified recombinant CCR3 maintains its native properties.

Methodological approach:

  • Chemokine binding assays using labeled CCR3 ligands (CCL11, CCL26, CCL7, CCL13, CCL5)

  • G protein activation assays measuring GTPγS binding

  • Calcium flux assays in cells expressing the recombinant receptor

  • Migration assays to confirm chemotactic functionality

  • Competitive binding assays with known CCR3 antagonists

For comprehensive validation, it is recommended to employ multiple functional assays rather than relying on a single method. This approach provides a more robust confirmation of proper receptor function.

How can I design experiments to investigate the role of CCR3 in Chlorocebus aethiops models of allergic inflammation?

Investigating CCR3's role in allergic inflammation requires careful experimental design to capture the receptor's contribution to eosinophil recruitment and activation.

Methodological approach:

  • Establish primary cell cultures from Chlorocebus aethiops tissues expressing CCR3

  • Design ex vivo systems using tissue explants to maintain physiological context

  • Implement CCR3 inhibition strategies:

    • Small molecule antagonists

    • Neutralizing antibodies

    • siRNA/shRNA-mediated knockdown

  • Measure endpoints relevant to allergic inflammation:

    • Eosinophil migration

    • Cytokine production

    • Cell adhesion molecule expression

    • Histamine release

When designing these experiments, it's crucial to include appropriate controls that account for potential off-target effects of inhibition strategies. Time-course studies are particularly valuable for capturing the dynamic nature of CCR3-mediated responses.

What are the current methods for studying CCR3 trafficking and surface mobilization in Chlorocebus aethiops cells?

Based on studies with human mast cells, CCR3 displays interesting trafficking dynamics, including storage in secretory granules and rapid mobilization to the cell surface upon FcεRI-mediated activation .

Methodological approach:

  • Real-time imaging:

    • Fluorescent protein tagging (ensuring tags don't interfere with trafficking)

    • Pulse-chase experiments with labeled antibodies

  • Flow cytometry:

    • Surface vs. intracellular staining (with saponin permeabilization)

    • Time-course analysis following cellular activation

  • Subcellular fractionation:

    • Isolation of membrane, cytosolic, and granular fractions

    • Western blotting for CCR3 in different fractions

Research has shown that activation of human mast cells through FcεRI increases surface CCR3 expression within 1 hour, with a parallel decrease in intracellular CCR3 as determined by flow cytometry on saponin-permeabilized cells . This suggests an intriguing mechanism whereby pre-formed CCR3 is rapidly mobilized to enhance cellular responsiveness to chemokines.

How should I address conflicting data regarding CCR3 expression patterns in different experimental systems?

Contradictory findings regarding CCR3 expression are reported in the literature. For example, some studies report CCR3 expression in resident cells of allografts without inflammation, while others find it in 61% of human inflammatory conditions .

Methodological approach:

  • Systematic analysis of methodological differences:

    • Antibody specificities and validation

    • Detection techniques (flow cytometry vs. immunohistochemistry)

    • Sample preparation methods

  • Consider biological variables:

    • Species differences (human vs. non-human primate vs. rodent)

    • Cell activation states

    • Tissue microenvironment

  • Implement multiple detection methods within the same study

  • Report comprehensive methodological details to facilitate cross-study comparisons

When encountering contradictory data, design experiments that directly address potential sources of variation. For instance, if discrepancies exist regarding CCR3 expression in specific cell types, implement single-cell analysis techniques to resolve heterogeneity that might be masked in bulk population studies.

What statistical approaches are most appropriate for analyzing CCR3 expression data in tissue samples?

The choice of statistical methods significantly impacts the interpretation of CCR3 expression data, particularly in comparative analyses.

Methodological approach:

  • For quantifying CCR3-positive cells:

    • Consider both absolute numbers and relative ratios

    • Define optimal cut-off values using ROC curve analysis

  • Multiple expression metrics can be calculated:

    • Absolute number of positive cells

    • Ratio of positive cells over renal parenchymal cells

    • Ratio of positive cells over lymphocytes plus monocytes/macrophages

  • Diagnostic performance metrics to consider:

    • Sensitivity and specificity

    • Positive predictive value (PPV)

    • Negative predictive value (NPV)

As illustrated in a study on transplant rejection biomarkers, the ratio of CCR3-positive cells over renal parenchymal cells or lymphocytes-monocytes achieved positive predictive values over 0.95 with cut-offs defined as 0.10 and 0.21, respectively . This demonstrates the importance of selecting appropriate normalization strategies when analyzing expression data.

What are the current approaches for studying CCR3-ligand interactions and designing CCR3 antagonists?

Advanced computational and experimental techniques can be employed to characterize CCR3-ligand interactions and develop potential therapeutic agents.

Methodological approach:

  • Computational modeling:

    • 5D-QSAR (Quantitative Structure-Activity Relationship) approaches that simulate induced fit

    • Receptor surrogate models that can predict binding affinities of novel compounds

  • Structure-guided design strategies:

    • Focus on lipophilic substitutions and amphiphilic H-bond acceptors

    • Target compounds with predicted binding affinities in the nanomolar range

A receptor modeling study using 5D-QSAR built receptor surrogates with cross-validated r² values of 0.950/0.861 and predictive r² of 0.879/0.798 . This model was used to predict the activity of 58 hypothetical compounds, identifying 11 ligands with calculated binding affinities lower than any compound in the training set, with the most potent candidate predicted to bind at an IC₅₀ of 0.3 nM .

How can I investigate the functional consequences of CCR3 activation beyond chemotaxis?

While CCR3 is primarily known for mediating chemotaxis, research suggests additional functional outcomes of receptor activation that merit investigation.

Methodological approach:

  • Cytokine production analysis:

    • Measure cytokine release following CCR3 activation

    • Investigate synergistic effects with other activation pathways

  • Experimental design considerations:

    • Sequential stimulation protocols

    • Time-course analyses

What are the key considerations when comparing CCR3 from Chlorocebus aethiops with CCR3 from other species in experimental systems?

Cross-species comparisons of CCR3 require careful attention to both structural and functional aspects of the receptor.

Methodological approach:

  • Sequence homology analysis:

    • Multiple sequence alignment of CCR3 from different species

    • Identification of conserved domains and variable regions

  • Functional comparison strategies:

    • Parallel expression systems for different species variants

    • Standardized ligand panels and concentration ranges

    • Identical assay conditions to minimize experimental variables

  • Data normalization considerations:

    • Expression level differences

    • Receptor coupling efficiency variations

    • Species-specific post-translational modifications

When conducting comparative studies, it's essential to verify antibody cross-reactivity with Chlorocebus aethiops CCR3 and validate detection methods for each species variant being studied.

What are emerging techniques for studying CCR3 function that may replace traditional approaches?

Research methodologies for studying chemokine receptors are continually evolving, with several cutting-edge approaches holding promise for CCR3 research.

Methodological approach:

  • CRISPR-Cas9 genome editing:

    • Precise modification of endogenous CCR3 in Chlorocebus aethiops cells

    • Generation of reporter cell lines with fluorescently tagged CCR3

  • Single-cell technologies:

    • Single-cell RNA sequencing to resolve heterogeneity in CCR3 expression

    • Mass cytometry for high-dimensional analysis of CCR3-expressing cells

  • Advanced imaging techniques:

    • Super-resolution microscopy for visualizing CCR3 nanodomains

    • Intravital imaging for tracking CCR3-dependent cell migration in vivo

  • Organoid technologies:

    • Development of tissue-specific organoids from Chlorocebus aethiops

    • Investigation of CCR3 function in physiologically relevant 3D environments

These emerging approaches offer opportunities to study CCR3 biology with unprecedented resolution and physiological relevance, potentially revealing novel aspects of receptor function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.