Recombinant Chlorocebus aethiops C-X-C chemokine receptor type 6 (CXCR6)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Chlorocebus aethiops (African green monkey) C-X-C chemokine receptor type 6 (CXCR6) is a heterologously expressed protein used to study chemokine receptor biology, viral pathogenesis (e.g., simian immunodeficiency virus/SIV), and immune cell interactions . CXCR6 belongs to the G protein-coupled receptor (GPCR) family and binds the chemokine ligand CXCL16, mediating leukocyte adhesion, migration, and immune signaling . Its recombinant form is engineered for experimental applications, including structural studies, ligand-receptor interaction assays, and antiviral research .

Primary Structure

  • Amino Acid Sequence: Full-length CXCR6 consists of 342 amino acids (UniProt ID: O18983) .

  • Key Domains:

    • N-terminal extracellular domain for ligand binding.

    • Seven transmembrane α-helices characteristic of GPCRs.

    • Intracellular C-terminal domain with a His-tag for purification .

Post-Translational Features

  • Expression System: Produced in Escherichia coli .

  • Tag: N-terminal His-tag for affinity chromatography .

  • Molecular Weight: ~39 kDa (theoretical), confirmed via SDS-PAGE .

ParameterDetails
SpeciesChlorocebus aethiops (African green monkey)
Protein Length342 amino acids (Full-length)
TagHis-tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -80°C
ReconstitutionSterile water + 50% glycerol for long-term stability

Viral Pathogenesis

CXCR6 serves as a coreceptor for SIV in African green monkeys, facilitating viral entry into CD4+ T cells. Key findings include:

  • SIVagmSab Entry: CXCR6, alongside CCR5 and GPR15, enables efficient SIV entry into sabaeus AGM lymphocytes. Blocking CXCR6 with CXCL16 inhibits viral replication more effectively than CCR5 antagonists .

  • Immune Evasion: Natural hosts (e.g., AGM) exhibit low CCR5 expression, favoring CXCR6-mediated infection to preserve CD4+ T cell homeostasis .

Immune Cell Dynamics

  • T Cell Recruitment: CXCR6 enhances cytotoxic T lymphocyte (CTL) adhesion to CXCL16-expressing tumor cells, improving antitumor responses in pancreatic cancer models .

  • Reverse Signaling: Transmembrane CXCL16 triggers ERK1/2 phosphorylation in glioblastoma cells via recombinant CXCR6, suggesting bidirectional signaling in cancer .

Key Research Applications

ApplicationExperimental Use
Viral Entry StudiesMechanistic analysis of SIV/HIV coreceptor usage in transfected cells .
Adoptive T Cell TherapyEngineering CXCR6+ T cells to enhance tumor homing and cytotoxicity .
Ligand-Receptor AssaysBinding kinetics of CXCL16 using surface plasmon resonance or flow cytometry .
Structural BiologyCryo-EM or X-ray crystallography to resolve CXCR6-CXCL16 interaction sites .

Comparative Insights from Mutational Studies

  • DRF Motif: Unlike most chemokine receptors with a DRY motif, CXCR6 harbors a DRF sequence at position 3.51. Mutating DRF→DRY enhances calcium signaling and migration but does not affect ligand binding or receptor recycling .

  • Species-Specific Variations: Chlorocebus aethiops CXCR6 shares 92% amino acid identity with human CXCR6, enabling cross-species functional studies .

Critical Research Findings

  1. CXCR6 in Natural SIV Hosts: AGM CXCR6 enables viral entry without CD4+ T cell depletion, offering insights into non-pathogenic SIV infection .

  2. Therapeutic Potential: CXCR6-transduced T cells exhibit superior tumor adhesion and cytotoxicity, supporting its use in cancer immunotherapy .

  3. Receptor Adaptation: The DRF motif limits chemotaxis while retaining adhesion, balancing immune cell recruitment and tissue retention .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
CXCR6; BONZO; C-X-C chemokine receptor type 6; CXC-R6; CXCR-6; G-protein coupled receptor bonzo; CD antigen CD186
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Target Names
Target Protein Sequence
MAEYDHYEDNGFNSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYH KLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWIFGQVMCKTLLGIYTINFYTSMLIL TCITVDRFIVVVKATKAYNQQAKKMTWGKVICLLIWVISLLVSLPQIIYGNVFNLDKLIC GYHDEEISTVVLATQMTLGFFLPLLAMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVF LLTQTPFNLVKLIRSTHWEYYAMTSFHYTIIVTEAIAYLRACLNPVLYAFVSLKFRKNFW KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
Uniprot No.

Target Background

Function
Receptor for the C-X-C chemokine CXCL16. Functions as a coreceptor for Simian Immunodeficiency Viruses (SIVs), certain HIV-2 strains, and M-tropic HIV-1 strains.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the key functional domains of CXCR6 important for ligand binding and viral entry?

CXCR6, like other chemokine receptors, contains several critical functional domains that determine its binding specificity and activity:

  • N-terminal extracellular domain (residues 1-34): This region is involved in initial interactions with the CXCL16 ligand and potentially with viral envelope proteins.

  • Transmembrane helices: The seven transmembrane domains create the core structure of this G-protein coupled receptor, forming a pocket for ligand binding.

  • Extracellular loops (ECLs): These regions contribute to ligand recognition and specificity, with ECL2 being particularly important for chemokine binding.

  • Intracellular loops and C-terminal domain: These regions mediate interactions with G proteins and other downstream signaling molecules.

For SIV entry studies, researchers should focus on the N-terminal domain and extracellular loops, as these regions are most likely to interact with viral envelope proteins during the entry process . Mutation studies targeting these regions can help identify specific residues critical for coreceptor function.

How do expression patterns of CXCR6 differ between Chlorocebus aethiops and other primate species?

CXCR6 expression patterns in Chlorocebus aethiops (African green monkey) show important distinctions from those observed in humans and other non-natural SIV hosts:

  • In African green monkeys (AGM), CXCR6 is expressed on specific subsets of CD4+ T cells that can support high-level viral replication without causing immune dysfunction.

  • This expression pattern differs significantly from human and macaque CXCR6 distribution, potentially explaining the differential pathogenesis of SIV/HIV infection.

  • In natural SIV hosts like AGM, CXCR6-expressing cells are often located in tissues that can sustain viral replication without disrupting critical immune functions.

This differential expression pattern is believed to be a key factor in the non-pathogenic nature of SIV infection in natural hosts compared to the progressive immunodeficiency seen in non-natural hosts .

How does CXCR6 function as a coreceptor for SIV entry in African green monkeys?

CXCR6 serves as a principal coreceptor for SIV entry in African green monkeys, particularly for SIVagmSab infection in sabaeus AGM. The protein works in conjunction with CD4 to facilitate viral entry into target cells through a multi-step process:

  • Initial attachment of the viral envelope glycoprotein to CD4

  • Conformational changes in the envelope protein exposing the coreceptor binding site

  • Engagement of CXCR6 by the envelope protein

  • Triggering of fusion between viral and cellular membranes

This coreceptor function has been experimentally validated through multiple approaches:

  • Pseudotype entry assays using SIVagmSab92018ivTF Env and genetically divergent env genes from wild-infected sabaeus AGM

  • Titration experiments comparing entry efficiency at limiting CD4/coreceptor levels

  • Blocking experiments using the natural CXCR6 ligand CXCL16

Importantly, blocking CXCR6 with CXCL16 significantly inhibits SIVagmSab replication in sabaeus peripheral blood mononuclear cells (PBMC), demonstrating a greater impact than CCR5 blocking using maraviroc .

What is the comparative efficiency of CXCR6 versus CCR5 in mediating SIV entry?

Research on SIVagmSab entry in sabaeus AGM demonstrates important differences in coreceptor efficiency between CXCR6 and CCR5:

CharacteristicCXCR6CCR5GPR15Other Coreceptors
Entry efficiency at optimal expressionHighHighModerateLow to minimal
Entry at limiting concentrationsEfficientEfficientLess efficientPoor
Inhibition impact on PBMC infectionSubstantialLess pronouncedNot testedNot tested
Importance in natural infectionPrimarySecondaryMinimalMinimal

How can researchers experimentally distinguish between CXCR6 and CCR5-mediated viral entry?

To differentiate between CXCR6 and CCR5-mediated SIV entry, researchers can employ the following methodological approaches:

  • Selective blocking experiments:

    • Use CXCL16 (the natural ligand for CXCR6) to specifically block CXCR6-mediated entry

    • Apply maraviroc or other CCR5 antagonists to block CCR5-mediated entry

    • Combine both blockers to assess additive effects

    • Compare viral replication under each blocking condition to determine relative contributions

  • Receptor expression modulation:

    • Generate cell lines expressing only CXCR6, only CCR5, or both receptors

    • Compare entry efficiency in each cell line using pseudotyped viruses

    • Use siRNA or CRISPR to selectively knock down each receptor in primary cells

  • Env mutant analysis:

    • Generate viral envelope mutants with altered coreceptor preferences

    • Characterize their entry patterns in cells expressing different coreceptors

    • Map determinants of coreceptor usage through chimeric envelope constructs

  • Quantitative fusion assays:

    • Develop cell-cell fusion assays with reporter systems linked to either CXCR6 or CCR5 expression

    • Measure fusion kinetics to assess relative efficiency of each pathway

What are the implications of CXCR6-mediated entry for SIV pathogenesis in natural hosts?

Research indicates that CXCR6-mediated entry represents a key adaptation in natural SIV hosts that contributes to the non-pathogenic nature of infection. This usage pattern has several important implications:

  • Altered cellular tropism: CXCR6-mediated entry may direct SIV toward distinct CD4+ T cell populations that can sustain viral replication without triggering systemic immune activation.

  • Tissue-specific targeting: The distribution of CXCR6-expressing cells differs from CCR5-expressing cells, potentially sparing critical immune compartments from depletion.

  • Preservation of immune homeostasis: By targeting cells through CXCR6, SIV in natural hosts appears able to replicate efficiently without causing the loss of CD4+ T cell homeostasis and lymphoid tissue damage that lead to AIDS in HIV-1 and SIVmac infections.

  • Evolutionary significance: The preferential use of CXCR6 appears to be a common feature across different natural SIV hosts (including sooty mangabeys and vervet monkeys), suggesting convergent evolution toward a less pathogenic virus-host relationship.

For researchers, these findings suggest that studying CXCR6 expression patterns in different T cell subsets and tissues may provide critical insights into the differential outcomes of SIV infection in natural versus non-natural hosts .

What expression systems are optimal for producing functional recombinant Chlorocebus aethiops CXCR6?

Based on published research, several expression systems have been successfully used for producing recombinant Chlorocebus aethiops CXCR6, each with specific advantages for different research applications:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, cost-effective, simple scale-upLimited post-translational modifications, potential folding issuesAntibody production, structural studies of soluble domains
YeastBetter protein folding, some post-translational modificationsLower yield than E. coliFunctional studies requiring partial glycosylation
Mammalian cellsNative-like post-translational modifications, proper foldingExpensive, lower yield, complex protocolsFunctional assays, binding studies, cell-based assays

For E. coli expression, the full-length protein (1-342aa) with an N-terminal His tag has been successfully produced, achieving purity >90% as determined by SDS-PAGE . For yeast-based expression, partial CXCR6 protein with purity >85% has been reported .

For functional studies requiring properly folded CXCR6, mammalian expression systems or specialized membrane protein expression systems like nanodiscs may be preferable, even though they typically provide lower yields.

What are the recommended protocols for assessing CXCR6 functionality in vitro?

To evaluate the functionality of recombinant Chlorocebus aethiops CXCR6, researchers should consider the following comprehensive assessment protocols:

  • Ligand binding assays:

    • Direct binding assays using labeled CXCL16 (the natural ligand)

    • Competition binding assays with unlabeled ligands

    • Saturation binding to determine Kd values

    • Binding kinetics using surface plasmon resonance

  • Signal transduction evaluation:

    • Calcium flux assays following ligand stimulation

    • ERK1/2 phosphorylation assessment

    • β-arrestin recruitment assays

    • GTPγS binding to measure G protein activation

  • Viral entry assays:

    • Pseudovirus entry using reporter viruses carrying SIVagmSab Env

    • Cell-cell fusion assays with Env-expressing cells

    • Inhibition studies using CXCL16 or other blockers

    • Comparative studies with other coreceptors (CCR5, GPR15)

  • Cellular localization and trafficking:

    • Immunofluorescence to confirm membrane localization

    • Receptor internalization following ligand exposure

    • FRET-based assays to measure receptor dimerization

    • Live-cell imaging to track receptor dynamics

These protocols should be optimized for the specific experimental system and research questions being addressed .

How should recombinant CXCR6 be stored and handled to maintain optimal activity?

Proper storage and handling of recombinant Chlorocebus aethiops CXCR6 is critical for maintaining its functional integrity. The following evidence-based guidelines should be followed:

  • Storage conditions:

    • Store lyophilized protein at -20°C to -80°C

    • The shelf life of lyophilized form is approximately 12 months at these temperatures

    • For liquid form, the shelf life is approximately 6 months at -20°C to -80°C

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

  • Working aliquots:

    • Store working aliquots at 4°C for up to one week only

    • Avoid repeated freeze-thaw cycles, as this can significantly degrade the protein

    • For multiple-use applications, prepare small single-use aliquots

  • Special considerations:

    • Use Tris/PBS-based buffer with 6% Trehalose at pH 8.0 for optimal stability

    • For functional assays, consider including protease inhibitors

    • When transferring between containers, use siliconized tubes to prevent protein adherence

These handling practices are particularly important for membrane proteins like CXCR6, which can rapidly lose structural integrity and functional activity if improperly stored or subjected to adverse conditions.

What are the most effective approaches for blocking CXCR6 function in experimental settings?

For researchers studying CXCR6 function in SIV infection models, several effective blocking strategies have been validated:

For rigorous experimental design, researchers should include appropriate controls including isotype antibodies, scrambled siRNAs, and combination blocking of multiple coreceptors to assess specificity and potential compensatory mechanisms .

How can Chlorocebus aethiops CXCR6 be used in comparative studies of HIV/SIV host adaptation?

Chlorocebus aethiops CXCR6 serves as a valuable tool for comparative studies of HIV/SIV host adaptation through the following research approaches:

  • Cross-species coreceptor utilization analysis:

    • Compare the efficiency of different SIV strains in utilizing CXCR6 from various primate species

    • Identify viral envelope determinants that govern species-specific CXCR6 usage

    • Map the evolutionary adaptations in both virus and host coreceptors

  • Pathogenesis comparison studies:

    • Develop in vitro systems expressing CXCR6 from different species to compare entry patterns

    • Create chimeric receptors to identify critical domains determining virus-host compatibility

    • Evaluate how CXCR6 usage correlates with pathogenic versus non-pathogenic outcomes

  • Molecular evolution investigations:

    • Analyze sequence conservation and divergence of CXCR6 across primate lineages

    • Identify positively selected residues that may represent virus-driven adaptation

    • Reconstruct ancestral CXCR6 sequences to track evolutionary changes

  • Transmission barrier assessment:

    • Determine how species-specific variations in CXCR6 contribute to cross-species transmission barriers

    • Identify minimal adaptations required for a virus to switch from CCR5 to CXCR6 usage

    • Map how coreceptor switching affects viral fitness and host cell targeting

These approaches can provide critical insights into the molecular basis of the non-pathogenic relationship between natural hosts and their SIV strains, potentially informing HIV therapeutic strategies.

What techniques are available for studying CXCR6 trafficking and signaling in live cells?

Advanced techniques for investigating CXCR6 trafficking and signaling dynamics in real-time include:

  • Live-cell imaging approaches:

    • Fluorescent protein tagging (GFP, mCherry) of CXCR6 for visualization

    • SNAP-tag and CLIP-tag labeling for pulse-chase receptor trafficking studies

    • Single-molecule tracking to monitor individual receptor movements

    • Super-resolution microscopy (PALM, STORM) for nanoscale localization

  • Resonance energy transfer techniques:

    • FRET sensors to detect CXCR6 conformational changes upon ligand binding

    • BRET assays to measure interactions with G proteins and β-arrestins

    • BiFC (Bimolecular Fluorescence Complementation) to visualize dimerization

    • DERET (Dissociation-Enhanced Receptor Transfer) for internalization kinetics

  • Biosensor applications:

    • CXCR6-specific conformational biosensors based on FlAsH technology

    • Calcium indicators for downstream signaling dynamics

    • FRET-based sensors for second messengers (cAMP, DAG, PIP2)

    • Optogenetic tools for spatiotemporal control of receptor activity

  • Advanced flow cytometry:

    • Phospho-flow cytometry to measure signaling cascade activation

    • Imaging flow cytometry for combined spatial and population analysis

    • High-content screening for trafficking modulators

    • Time-of-flight mass cytometry for comprehensive signaling profiling

These techniques allow researchers to dissect the dynamics of CXCR6 function with unprecedented temporal and spatial resolution, providing insights into how this receptor mediates both normal chemokine signaling and pathogenic viral entry.

How does CXCR6 targeting affect immune cell recruitment and function in non-human primate models?

CXCR6 targeting has significant implications for immune cell dynamics in non-human primate models, particularly in the context of SIV infection:

  • T cell subset targeting:

    • CXCR6 expression defines specific CD4+ T cell populations that can support SIV replication

    • These CXCR6+ cells appear to differ from critical CCR5+ central memory T cells that are depleted in pathogenic infections

    • Targeting CXCR6+ cells may alter the balance of effector versus memory T cell populations

  • Tissue-specific immune responses:

    • CXCR6 and its ligand CXCL16 regulate T cell trafficking to specific tissues

    • In natural SIV hosts, CXCR6-mediated localization may concentrate infection in tissues that can contain viral replication without systemic immune activation

    • Blocking CXCR6 can potentially redistribute immune responses across different anatomical compartments

  • Inflammatory regulation:

    • CXCR6+ T cells include Th1 polarized cells important for cell-mediated immunity

    • The CXCL16-CXCR6 axis plays roles in both homeostatic and inflammatory conditions

    • Targeting this pathway may modulate chronic inflammation associated with pathogenic infection

  • Impact on viral reservoirs:

    • CXCR6-expressing cells may constitute specific viral reservoir populations

    • Targeting CXCR6 could potentially affect the establishment and maintenance of these reservoirs

    • The anatomical distribution of CXCR6+ cells influences where viral persistence occurs

Understanding these dynamics is crucial for developing strategies to modulate immune responses in HIV/SIV infection and potentially for approaches to target viral reservoirs.

What are the current challenges in developing CXCR6-based interventions for HIV/SIV research?

Researchers developing CXCR6-based interventions for HIV/SIV studies face several significant challenges:

  • Structural and functional complexity:

    • Limited availability of high-resolution structures for primate CXCR6

    • Incomplete understanding of species-specific differences in CXCR6 function

    • Difficulty in expressing and purifying functional membrane proteins for structural studies

  • Specificity and cross-reactivity issues:

    • Ensuring specificity when targeting CXCR6 versus other chemokine receptors

    • Potential unintended consequences of blocking CXCR6's physiological functions

    • Species differences that limit translation between animal models and humans

  • Technical limitations:

    • Need for improved tools to track CXCR6-expressing cells in vivo

    • Challenges in developing small molecules with appropriate pharmacokinetics

    • Difficulties in quantifying CXCR6 expression levels on specific cell subsets

  • Biological complexity:

    • Redundancy in coreceptor usage by some viral strains

    • Dynamic regulation of CXCR6 expression in different immunological contexts

    • Tissue-specific effects that may not be captured in blood-based assays

  • Translational barriers:

    • Uncertainty about how findings in natural hosts will translate to human applications

    • Limited access to appropriate non-human primate models

    • Challenges in designing clinical studies based on CXCR6-targeted interventions

Addressing these challenges requires multidisciplinary approaches combining structural biology, molecular virology, immunology, and drug development expertise. Collaborative efforts between academic and industry researchers will be essential for advancing CXCR6-based interventions from concept to practical application .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.