Recombinant Chlorocebus aethiops CD9 antigen (CD9)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Biological Systems

While the recombinant protein itself is non-functional in isolation, its study informs CD9’s roles in:

  • Sperm-egg fusion: CD9 interacts with integrins (e.g., α6β1) and sperm ADAM proteins to facilitate fertilization .

  • Viral modulation: CD9 inhibits HIV-1-induced syncytia formation by arresting hemifusion , though its role in Chlorocebus aethiops systems remains unexplored.

  • Immune regulation: Associates with MHC-II and integrins in dendritic cells to regulate antigen presentation .

Production and Quality Control

The recombinant Chlorocebus aethiops CD9 is produced via bacterial expression, with stringent quality assurance:

ParameterDetail
Expression HostE. coli (plasmid-based)
Expression ConditionsOptimized for solubility and proper folding
Purification MethodAffinity chromatography (His tag)
Contaminant TestingValidated via SDS-PAGE (5% stacking, 15% resolving gel)
StabilityLyophilized powder; avoid repeated freeze-thaw cycles

Comparative Analysis with Human CD9

Key differences between Chlorocebus aethiops and human CD9 recombinant proteins include:

FeatureChlorocebus aethiops CD9Human CD9
Host SystemE. coliWheat germ, mammalian cells
TagHisHis, GST, Fc-Avi
Protein LengthFull-length (2–228 aa)Fragment (112–195 aa, wheat germ)
ApplicationsStructural studies, viral researchELISA, WB, SDS-PAGE
Purity>90% (SDS-PAGE)>95% (HPLC, SEC)

Data compiled from .

Research Applications

This recombinant protein serves as a tool for:

  • Structural studies: Mapping TM domains and extracellular loops critical for tetraspanin interactions .

  • Viral entry mechanisms: Investigating CD9’s role in modulating viral fusion (e.g., morbilliviruses) .

  • Therapeutic target validation: Screening CD9 inhibitors for cancer or inflammatory diseases .

Challenges and Considerations

  • Functional limitations: Lacks post-translational modifications (e.g., glycosylation) due to bacterial expression .

  • Handling requirements: Lyophilized aliquots must be stored at -20°C/-80°C to prevent degradation .

  • Species specificity: Results may not directly translate to human systems due to evolutionary divergence in tetraspanin domains .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery information, please consult your local distributors.
Note: All protein shipments are accompanied by standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CD9; CD9 antigen; 27 kDa diphtheria toxin receptor-associated protein; DRAP27; CD antigen CD9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-228
Protein Length
Full Length of Mature Protein
Species
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Target Names
CD9
Target Protein Sequence
PVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVY ILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEV QEFYKDTYNKLKTKDEPQRETLKAIHYALDCCGLAGGVEQFISDICPKKDVLETFTIKSC PDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Uniprot No.

Target Background

Function
CD9, an integral membrane protein associated with integrins, plays a crucial role in regulating various cellular processes, including sperm-egg fusion, platelet activation and aggregation, and cell adhesion. It is expressed on the cell surface of oocytes and is essential for sperm-egg fusion, potentially by organizing multiprotein complexes and influencing the membrane morphology required for fusion. In myoblasts, CD9 interacts with CD81 and PTGFRN, inhibiting myotube fusion during muscle regeneration. In macrophages, CD9 associates with CD81 and beta-1 and beta-2 integrins, preventing macrophage fusion into multinucleated giant cells, which specialize in ingesting complement-opsonized large particles. Additionally, it prevents the fusion of mononuclear cell progenitors into osteoclasts, responsible for bone resorption. CD9 acts as a receptor for PSG17 and is involved in platelet activation and aggregation. It also regulates paranodal junction formation and participates in cell adhesion, cell motility, and tumor metastasis.
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Secreted, extracellular exosome.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.