Recombinant Chlorocebus aethiops Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UQCRFS1; Cytochrome b-c1 complex subunit Rieske, mitochondrial; Complex III subunit 5; Cytochrome b-c1 complex subunit 5; Rieske iron-sulfur protein; RISP; Rieske protein UQCRFS1; Ubiquinol-cytochrome c reductase iron-sulfur subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
79-274
Protein Length
Full Length of Mature Protein
Species
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Target Names
Target Protein Sequence
SHTDVKVPDFYDYRRLEVLDSTKSSRESSEARKGFSYLVTAVTTVGVAYAAKNVVTQFIS SMSASADVLAMAKIEINLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEEEAAVELSQLRDP QHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNL EVPPYEFTGDDVVVVG
Uniprot No.

Target Background

Function

UQCRFS1 (Cytochrome b-c1 complex subunit Rieske, mitochondrial) is a component of the ubiquinol-cytochrome c oxidoreductase (complex III, CIII), a crucial transmembrane complex within the mitochondrial electron transport chain (ETC). The ETC drives oxidative phosphorylation, a process where electrons from NADH and succinate are transferred to molecular oxygen, generating a proton gradient across the inner mitochondrial membrane. This gradient powers ATP synthesis. Complex III, along with succinate dehydrogenase (complex II) and cytochrome c oxidase (complex IV), facilitates this electron transfer. Complex III catalyzes electron transfer from ubiquinol to cytochrome c, simultaneously translocating protons across the inner mitochondrial membrane via the Q cycle. This cycle involves the consumption of two matrix protons, the release of four protons into the intermembrane space, and the transfer of two electrons to cytochrome c. The Rieske protein, a key catalytic subunit of UQCRFS1, contains an iron-sulfur cluster. Following its incorporation into the complex III dimer, UQCRFS1 undergoes proteolytic processing. One fragment, subunit 9, corresponds to its mitochondrial targeting sequence (MTS). This processing is essential for proper UQCRFS1 integration into the complex III dimer. However, persistent UQCRFS1-derived fragments can hinder the processing and assembly of newly imported UQCRFS1, negatively impacting complex III structure and function.

Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is UQCRFS1 and what role does it play in mitochondrial function?

UQCRFS1 (Ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1) is an essential subunit of the respiratory chain protein Ubiquinol Cytochrome c Reductase (Complex III or Cytochrome bc1 complex) in the mitochondrial respiratory chain. The protein contains an iron-sulfur cluster that plays a critical role in electron transfer. In humans, UQCRFS1 is a 29.7 kDa protein composed of 274 amino acids, located on chromosome 19q12, with a gene that spans 5,969 base pairs and contains 2 exons . The Chlorocebus aethiops UQCRFS1 maintains high structural homology with human UQCRFS1, making it valuable for comparative studies. Complex III's function in electron transport is crucial for oxidative phosphorylation, and UQCRFS1 is the final subunit incorporated that enables enzymatic activity of the complex .

What is the structural organization of the UQCRFS1 protein in Chlorocebus aethiops?

The UQCRFS1 protein in Chlorocebus aethiops is structurally similar to other mammalian Rieske iron-sulfur proteins. The primary structure includes a characteristic N-terminal extension sequence approximately 78 amino acids long that serves as a cleavable mitochondrial targeting sequence . Following import into mitochondria via the TOM and TIM23 pathway, this precursor protein undergoes processing where the N-terminal part is cleaved but remains bound to Complex III, positioned between the two core subunits (UQCRC1 and UQCRC2) . The mature protein contains a transmembrane domain (identified as UCR_TM in protein databases) and the catalytic domain housing the iron-sulfur cluster. This iron-sulfur cluster typically exhibits a distinctive EPR signal with a gy = 1.90 characteristic that is diagnostic of properly assembled Rieske proteins .

How does UQCRFS1 assembly into Complex III occur?

UQCRFS1 assembly into Complex III follows a defined pathway:

  • Synthesis of UQCRFS1 precursor protein in the cytosol

  • Import into mitochondria via the TOM and TIM23 import machinery

  • Processing in the mitochondrial matrix to remove the targeting sequence

  • Incorporation of the iron-sulfur cluster

  • Integration as the final subunit into the pre-assembled Complex III

The incorporation of UQCRFS1 represents the maturation step that renders Complex III catalytically active. Notably, during UQCRFS1 assembly, the precursor undergoes proteolytic processing, but its N-terminal fragment remains associated with the complex . This assembly is regulated by specific assembly factors, including TTC19, which appears to play a quality control role in UQCRFS1 processing. In TTC19-deficient models, accumulation of UQCRFS1-derived N-terminal fragments has been observed, which negatively impacts Complex III function .

What expression systems are most suitable for producing recombinant Chlorocebus aethiops UQCRFS1?

For recombinant production of Chlorocebus aethiops UQCRFS1, several expression systems can be employed, each with distinct advantages:

Expression SystemAdvantagesLimitationsIron-Sulfur Cluster Assembly
E. coliFast growth, high yield, economicalLimited post-translational modificationsPartial assembly with altered EPR characteristics
Insect cellsBetter protein folding, some post-translational modificationsModerate yield, more expensiveImproved but not native assembly
Mammalian cellsNative-like post-translational modificationsLower yield, expensive, time-consumingMost native-like assembly
Rhodobacter sphaeroidesNative membrane integrationSpecialized culture conditionsFully metalated with diagnostic gy = 1.90 EPR signal

Based on experimental evidence, expression of full-length UQCRFS1 in E. coli results in incorporation into the cytoplasmic membrane with partial assembly of a Rieske-like iron-sulfur cluster, although with EPR characteristics that differ from the native signal . For studies requiring fully functional protein with properly assembled iron-sulfur clusters, expression in Rhodobacter sphaeroides has demonstrated successful assembly of the diagnostic gy = 1.90 EPR signal even in the absence of other Complex III components .

What purification strategies yield the highest activity for recombinant UQCRFS1?

Effective purification of active recombinant UQCRFS1 requires strategies that preserve the integrity of the iron-sulfur cluster:

  • Membrane Preparation: Begin with gentle membrane solubilization using mild detergents (0.5-1% n-dodecyl-β-D-maltoside or digitonin)

  • Affinity Chromatography: Utilize one of the following approaches:

    • Fusion protein strategies (e.g., MBP-fusion)

    • His-tagged constructs with metal affinity chromatography

    • Antibody-based affinity purification using validated antibodies against UQCRFS1

  • Iron-Sulfur Cluster Preservation:

    • Maintain anaerobic conditions during purification

    • Include reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol)

    • Avoid freeze-thaw cycles that destabilize the iron-sulfur cluster

  • Assessment of Activity:

    • EPR spectroscopy to confirm iron-sulfur cluster integrity (gy = 1.90 signal)

    • Enzymatic activity assays measuring electron transfer rates

When designing constructs, consider that subfragments of the Rieske subunit lacking the amino-terminal hydrophobic anchor typically lack the iron-sulfur cluster . The fully metalated UQCRFS1 with the diagnostic EPR signal is most reliably obtained when the complete protein, including the membrane anchor, is expressed.

How can researchers verify the integrity of the iron-sulfur cluster in recombinant UQCRFS1?

Verification of iron-sulfur cluster integrity in recombinant UQCRFS1 requires multiple complementary approaches:

  • Spectroscopic Analysis:

    • UV-visible absorption spectroscopy (characteristic peaks at 330, 430, and 500 nm)

    • Electron Paramagnetic Resonance (EPR) - properly assembled Rieske cluster shows rhombic signal with gy = 1.90

    • Circular dichroism spectroscopy to assess secondary structure integrity

  • Functional Assays:

    • Electron transfer activity using decylubiquinol and cytochrome c

    • Sensitivity to specific inhibitors (e.g., myxothiazol, stigmatellin)

  • Western Blot Analysis:

    • Using validated antibodies against UQCRFS1 (e.g., Rabbit pAb)

    • Expected molecular weight of approximately 23-30 kDa (observed vs. calculated)

  • Mass Spectrometry:

    • Integrity of the full protein structure

    • Confirmation of iron and sulfur incorporation

The observation of EPR characteristics that differ from the normal rhombic signal may indicate incomplete or improper assembly of the iron-sulfur cluster, as observed in some recombinant expression systems .

How does UQCRFS1 dysfunction contribute to pathological conditions?

UQCRFS1 dysfunction has been implicated in several pathological conditions:

  • Mitochondrial Complex III Deficiency: UQCRFS1 is implicated in mitochondrial complex III deficiency (MC3DN10) , characterized by:

    • Disrupted electron transport chain function

    • Decreased ATP production

    • Increased reactive oxygen species (ROS) generation

    • Tissue-specific manifestations depending on energy demands

  • Cancer Progression: UQCRFS1 has been reported to be highly expressed in several cancers, including:

    • Epithelial ovarian cancer (EOC) - associated with poor prognosis

    • Gastric cancer

    • Breast cancer

    Mechanistically, UQCRFS1 overexpression appears to promote cancer progression through:

    • Enhanced cell proliferation

    • Cell cycle progression

    • Inhibition of apoptosis

    • Modulation of ROS levels

    • Activation of the AKT/mTOR signaling pathway

  • Oxidative Stress-Related Disorders: As a key component of the mitochondrial respiratory chain, UQCRFS1 dysfunction affects ROS homeostasis:

    • UQCRFS1 knockdown significantly increases ROS production

    • Elevated ROS leads to DNA damage with upregulation of ATM and ATR expression

    • Chronic oxidative stress contributes to aging and degenerative diseases

Understanding these pathological mechanisms provides potential therapeutic targets for intervention in Complex III-related diseases and cancer.

What phenotypic effects are observed following UQCRFS1 knockdown in cellular models?

Knockdown of UQCRFS1 in cellular models produces multiple significant phenotypic effects:

  • Cellular Proliferation:

    • Reduced cell proliferation rates as measured by CCK8 assay

  • Cell Cycle Regulation:

    • G1 phase cell cycle arrest

    • Decreased percentage of cells in S phase

    • Reduction in expression of cell cycle regulatory proteins:

      • Cyclin D1

      • CDK2

      • CDK4

  • Apoptotic Response:

    • Increased proportion of apoptotic cells measured by flow cytometry

  • Oxidative Stress:

    • Markedly enhanced ROS production detected by DCFH-DA fluorescence

    • The mitochondrial respiratory chain disruption leads to increased electron leakage

  • DNA Damage Response:

    • Upregulation of DNA damage response genes:

      • ATM and ATR (upregulated)

      • CHK1 and CHK2 (downregulated)

  • Signaling Pathway Alterations:

    • Inhibition of the AKT/mTOR pathway

These findings suggest that UQCRFS1 plays crucial roles beyond its canonical function in the electron transport chain, potentially serving as a link between mitochondrial function, cell cycle regulation, and cellular stress responses.

What methodologies are most effective for studying UQCRFS1 function in animal models?

Several methodologies have proven effective for studying UQCRFS1 function in animal models:

  • Animal Model Selection:

    • African green monkeys (vervets; Chlorocebus aethiops sabaeus) provide a valuable non-human primate model with high translational relevance

    • Rodent models allow for genetic manipulations and larger sample sizes

    • Specialized models like Rhodobacter sphaeroides lacking other bc1 complex subunits can isolate UQCRFS1 function

  • Genetic Modification Approaches:

    • CRISPR/Cas9-mediated gene editing for knockout or knockin models

    • Conditional knockout systems (Cre-loxP) for tissue-specific or inducible deletion

    • Viral vector delivery of shRNA for targeted knockdown in specific tissues

  • Functional Assessments:

    • Biochemical analyses of respiratory chain complexes from isolated mitochondria

    • Seahorse XF Analyzer for measuring oxygen consumption rates and mitochondrial function

    • In vivo metabolic phenotyping:

      • Exercise tolerance

      • Metabolic chamber analyses

      • Tissue-specific energy utilization

  • Molecular Analyses:

    • RNA-seq for transcriptome-wide effects

    • Proteomic profiling to assess protein expression changes

    • Metabolomic analyses to identify altered metabolic pathways

  • Animal-Specific Considerations:

    • For non-human primates like Chlorocebus aethiops, careful dietary control and standardized housing conditions are essential, as demonstrated in studies using these models for metabolic research

    • Age and sex should be carefully documented and controlled, as significant variations exist between male and female animals (males: 5.12-9.01 kg; females: 3.90-7.03 kg)

The complexity of UQCRFS1 function requires comprehensive phenotyping using multiple complementary approaches.

How conserved is UQCRFS1 structure and function across different species?

UQCRFS1 demonstrates remarkable evolutionary conservation across species, reflecting its fundamental role in cellular respiration:

SpeciesStructural ConservationFunctional ConservationUnique Features
HumanReference (274 amino acids)Complete Complex III assemblyImplicated in cancer and mitochondrial disorders
Chlorocebus aethiopsHigh homology to humanSimilar Complex III assemblyValuable non-human primate model
Mouse/RatHigh core domain conservationFunctionally equivalentUsed in knockout models
Rhodobacter sphaeroidesConserved catalytic domainFunctional in bacterial respirationCan assemble iron-sulfur cluster independently

The core functional domain containing the iron-sulfur cluster shows the highest conservation, while the N-terminal region exhibits more variation across species. Despite these differences, the essential function in electron transport is preserved. Interestingly, when expressed in Rhodobacter sphaeroides in the absence of other cytochrome bc1 complex components, the fully metalated Rieske subunit with the diagnostic gy = 1.90 EPR signal is observed in the cytoplasmic membrane, demonstrating evolutionary conservation of the core assembly mechanism .

The high degree of conservation makes comparative studies valuable for understanding fundamental aspects of UQCRFS1 function while species-specific differences may provide insights into adaptations to different metabolic demands.

What are the key considerations when extrapolating findings from Chlorocebus aethiops UQCRFS1 to human applications?

When extrapolating findings from Chlorocebus aethiops UQCRFS1 studies to human applications, researchers should consider several important factors:

  • Sequence and Structural Homology:

    • While the core functional domains are highly conserved, subtle sequence variations may affect:

      • Protein-protein interactions with other complex components

      • Post-translational modifications

      • Regulatory mechanisms

  • Physiological Context:

    • Metabolic differences between species:

      • Basal metabolic rate

      • Dietary adaptations

      • Lifespan and aging processes

    • These differences may influence the phenotypic consequences of UQCRFS1 alterations

  • Experimental Design Considerations:

    • Standardized housing and dietary conditions for vervets are crucial for translational research

    • Age and sex matching is important as significant physiological differences exist between male and female animals

    • Consideration of genetic diversity within Chlorocebus aethiops populations

  • Disease Modeling:

    • While vervets provide valuable models for human diseases, species-specific differences in disease susceptibility and progression must be acknowledged

    • Complex III deficiency may manifest differently between species

    • Cancer models may not fully recapitulate human disease progression

  • Pharmacological Responses:

    • Differences in drug metabolism between species

    • Potential variations in toxicity profiles

    • Differences in bioavailability and tissue distribution

The use of multiple model systems, including in vitro human cell models alongside Chlorocebus aethiops studies, can help bridge these translational gaps.

How can researchers optimize recombinant UQCRFS1 expression to maintain iron-sulfur cluster integrity?

Optimizing recombinant UQCRFS1 expression with intact iron-sulfur clusters requires attention to several critical factors:

  • Expression Construct Design:

    • Include the complete protein sequence including the N-terminal hydrophobic anchor, as subfragments lacking this region typically fail to assemble functional iron-sulfur clusters

    • Consider fusion protein strategies carefully - while MBP fusion proteins localize to the membrane, they may not contain EPR-detectable iron-sulfur clusters

  • Expression Conditions:

    • Temperature: Lower expression temperatures (16-25°C) often improve protein folding

    • Iron supplementation: Add ferric ammonium citrate (0.1-0.5 mM) to culture media

    • Sulfur source: Supplement with cysteine or methionine

    • Microaerobic conditions may improve iron-sulfur cluster assembly

  • Host Selection:

    • Expression in Rhodobacter sphaeroides has demonstrated success in producing fully metalated Rieske protein with the diagnostic gy = 1.90 EPR signal

    • For mammalian expression, consider HEK293 or CHO cells with mitochondrial targeting

  • Co-expression Strategies:

    • Co-express iron-sulfur cluster assembly machinery components

    • In heterologous bacterial systems, co-express bacterial iron-sulfur cluster assembly proteins

  • Membrane Integration:

    • The Rieske subunit demonstrates membrane attachment independent of other components of the bc1 complex

    • Ensure expression systems support proper membrane integration

These optimizations significantly improve the yield of functional recombinant UQCRFS1 with properly assembled iron-sulfur clusters, essential for meaningful functional studies.

What experimental challenges arise when studying UQCRFS1's role in the context of complete Complex III, and how can they be addressed?

Studying UQCRFS1 within the context of complete Complex III presents several experimental challenges:

  • Complex Assembly and Stability:

    • Challenge: UQCRFS1 is the last incorporated subunit in Complex III assembly

    • Solution: Stage-specific isolation techniques using gentle detergent solubilization and blue native PAGE separation

  • Processing and Maturation:

    • Challenge: During assembly, UQCRFS1 undergoes processing where its N-terminal part remains bound to the complex

    • Solution: Use of antibodies specific to different regions of UQCRFS1 to track processing intermediates

  • Quality Control Mechanisms:

    • Challenge: Factors like TTC19 regulate UQCRFS1 processing, and their absence leads to accumulation of N-terminal fragments

    • Solution: Comparative studies between wild-type and TTC19-deficient models to understand processing dynamics

  • Structural Analysis:

    • Challenge: Determining UQCRFS1 position and interactions within the multi-subunit complex

    • Solution: Cryo-EM approaches combined with crosslinking mass spectrometry to map interaction interfaces

  • Functional Assessment:

    • Challenge: Distinguishing UQCRFS1-specific effects from general Complex III dysfunction

    • Solution:

      • Point mutations affecting specific UQCRFS1 functions

      • Complementation studies with modified UQCRFS1 variants

      • Time-resolved incorporation studies

  • ROS Generation:

    • Challenge: Complex III is a major site of ROS production, making it difficult to isolate UQCRFS1-specific contributions

    • Solution: Site-directed mutagenesis of specific residues in UQCRFS1 combined with targeted ROS detection methods

Understanding these challenges and implementing appropriate experimental strategies allows for more precise characterization of UQCRFS1's role within Complex III.

How do ROS levels influence UQCRFS1 function, and what methodologies best assess this relationship?

The relationship between ROS levels and UQCRFS1 function represents a critical area of research:

  • Bidirectional Relationship:

    • UQCRFS1 dysfunction increases ROS production through:

      • Disrupted electron flow through Complex III

      • Electron leakage to molecular oxygen

    • Elevated ROS can damage UQCRFS1 and its iron-sulfur cluster through:

      • Direct oxidation of sulfur atoms in the cluster

      • Modification of coordinating amino acid residues

      • Altered protein-protein interactions

  • Methodological Approaches for Assessment:

    a. ROS Detection Methods:

    • Fluorescent probes:

      • DCFH-DA for general cellular ROS

      • MitoSOX Red for mitochondria-specific superoxide

      • Amplex Red for hydrogen peroxide

    • EPR spin-trapping techniques for specific radical species

    • Genetically encoded redox sensors (roGFP, HyPer)

    b. UQCRFS1 Functional Assessment Under Oxidative Stress:

    • Spectroscopic monitoring of iron-sulfur cluster integrity

    • Activity assays under controlled redox conditions

    • Thiol status analysis of critical cysteine residues

    c. In Vivo Models:

    • Inducible oxidative stress models

    • Antioxidant depletion strategies (GSH depletion, SOD inhibition)

    • Genetic models with altered ROS handling capacity

  • Experimental Findings:

    • UQCRFS1 knockdown significantly increases ROS production as detected by DCFH-DA

    • Elevated ROS correlates with DNA damage gene expression changes, including upregulation of ATM and ATR

    • The UQCRFS1-ROS relationship appears linked to cell cycle regulation and apoptotic pathways

  • Analytical Considerations:

    • Use multiple complementary ROS detection methods

    • Carefully control for artifactual ROS generation during sample preparation

    • Consider compartment-specific ROS dynamics (matrix vs. intermembrane space)

This methodological framework enables researchers to dissect the complex interplay between UQCRFS1 function and cellular redox homeostasis.

What emerging technologies show promise for advancing UQCRFS1 research?

Several cutting-edge technologies are poised to transform UQCRFS1 research:

  • Cryo-Electron Microscopy and Tomography:

    • High-resolution structural analysis of UQCRFS1 within the native Complex III environment

    • Visualization of conformational changes during electron transfer

    • Mapping of interaction interfaces with other complex components

  • CRISPR-Based Technologies:

    • Base editing for precise introduction of disease-associated mutations

    • CRISPRi/CRISPRa for temporal control of UQCRFS1 expression

    • CRISPR screening to identify genetic modifiers of UQCRFS1 function

  • Single-Cell Multi-Omics:

    • Integrated analysis of transcriptome, proteome, and metabolome at single-cell resolution

    • Cell-specific responses to UQCRFS1 dysfunction

    • Identification of compensatory mechanisms

  • Advanced Imaging Techniques:

    • Super-resolution microscopy of mitochondrial dynamics during UQCRFS1 dysfunction

    • FRET-based sensors for real-time monitoring of electron transfer

    • Correlative light and electron microscopy for structure-function studies

  • Protein Engineering Approaches:

    • Designer iron-sulfur clusters with altered redox properties

    • Bio-orthogonal chemistry for in situ labeling and tracking

    • Optogenetic control of UQCRFS1 function

  • Organoid and Tissue-on-Chip Models:

    • Three-dimensional culture systems recapitulating tissue-specific UQCRFS1 functions

    • Microfluidic systems for analyzing metabolic consequences of UQCRFS1 alterations

    • Patient-derived organoids for personalized disease modeling

These technologies promise to overcome current limitations in understanding UQCRFS1 biology and develop novel therapeutic strategies for related disorders.

How might targeting UQCRFS1 function be exploited for therapeutic interventions in cancer and mitochondrial diseases?

The potential for therapeutic targeting of UQCRFS1 spans several promising approaches:

  • Cancer Therapeutic Strategies:

    • Direct UQCRFS1 Inhibition:

      • Small molecule inhibitors targeting the iron-sulfur cluster or electron transfer

      • Peptide-based inhibitors disrupting UQCRFS1 assembly into Complex III

    • Metabolic Vulnerability Exploitation:

      • UQCRFS1 knockdown induces G1 phase cell cycle arrest and reduces expression of cell cycle regulatory proteins

      • Combination therapies targeting both UQCRFS1 and compensatory metabolic pathways

    • ROS Modulation:

      • Pro-oxidant therapies may selectively harm cancer cells with UQCRFS1 overexpression

      • UQCRFS1 knockdown increases ROS production , which could be exploited in combination with ROS-sensitizing agents

  • Mitochondrial Disease Approaches:

    • Protein Replacement Therapies:

      • Delivery of functional recombinant UQCRFS1 to affected tissues

      • mRNA therapeutics for transient expression of functional protein

    • Assembly Factor Modulation:

      • Targeting factors like TTC19 that regulate UQCRFS1 processing and assembly

      • Small molecules promoting proper assembly and preventing accumulation of toxic processing intermediates

    • Bypass Strategies:

      • Alternative electron carriers to bypass Complex III deficiency

      • Metabolic rewiring to reduce dependence on oxidative phosphorylation

  • Delivery Challenges and Solutions:

    • Mitochondrial-targeted delivery systems:

      • Lipophilic cations (TPP+)

      • Mitochondrial targeting sequences

      • Nanoparticle-based delivery platforms

    • Tissue-specific targeting:

      • Antibody-drug conjugates for cancer-specific delivery

      • Viral vectors for tissue-selective expression

  • Biomarker Development:

    • Companion diagnostics for UQCRFS1-targeted therapies:

      • Expression levels in cancer tissues

      • Functional status assessment in mitochondrial diseases

      • Genetic variants affecting drug response

The therapeutic targeting of UQCRFS1 represents an emerging frontier that bridges fundamental mitochondrial biology with clinical applications in both cancer and mitochondrial disorders.

What are the most significant unresolved questions in UQCRFS1 research?

Despite advances in understanding UQCRFS1 biology, several critical questions remain unresolved:

  • Structure-Function Relationships:

    • Precise mechanistic understanding of how UQCRFS1 structure facilitates electron transfer

    • Conformational changes during catalytic cycle

    • Detailed mapping of interaction interfaces with other Complex III components

  • Regulatory Mechanisms:

    • Factors controlling UQCRFS1 expression under different physiological conditions

    • Post-translational modifications regulating UQCRFS1 activity

    • Degradation pathways and turnover rates in different tissues

  • Disease Mechanisms:

    • How UQCRFS1 overexpression contributes to cancer progression beyond effects on proliferation and apoptosis

    • Tissue-specific manifestations of UQCRFS1 dysfunction in mitochondrial diseases

    • Compensatory mechanisms in response to chronic UQCRFS1 deficiency

  • Evolutionary Adaptations:

    • Functional significance of species-specific variations in UQCRFS1 sequence

    • Adaptive changes in response to different metabolic demands

    • Co-evolution with other respiratory chain components

  • Non-canonical Functions:

    • Potential roles beyond respiratory chain electron transfer

    • Signaling functions in stress response pathways

    • Interactions with cytosolic proteins and other cellular components

Addressing these questions will require integrated approaches combining structural biology, genetics, biochemistry, and systems biology perspectives.

What standardized methodologies would benefit the UQCRFS1 research community?

The development and adoption of standardized methodologies would significantly advance UQCRFS1 research:

  • Recombinant Protein Production:

    • Standardized expression constructs for different species

    • Optimized protocols for maintaining iron-sulfur cluster integrity

    • Quality control criteria for functional recombinant protein

  • Functional Assays:

    • Consensus protocols for measuring electron transfer activity

    • Standardized methods for assessing ROS production

    • Validated antibodies for consistent detection and quantification

  • Animal Models:

    • Well-characterized knockout and knockin models

    • Standardized phenotyping protocols

    • Consistent housing and dietary conditions for non-human primate models

  • Data Reporting:

    • Minimum information standards for UQCRFS1 experiments

    • Repositories for sharing raw data and protocols

    • Standardized nomenclature for mutations and variants

  • Clinical Correlations:

    • Validated biomarkers for UQCRFS1 dysfunction

    • Consistent criteria for diagnosing UQCRFS1-related mitochondrial diseases

    • Standardized approaches for evaluating UQCRFS1 in cancer tissues

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.