Recombinant Chlorocebus aethiops Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chlorocebus aethiops Cytochrome c Oxidase Subunit 2 (MT-CO2)

Recombinant Chlorocebus aethiops Cytochrome c oxidase subunit 2 (MT-CO2) is a protein derived from the African green monkey (Chlorocebus aethiops), specifically focusing on the cytochrome c oxidase complex. This complex is crucial in the mitochondrial electron transport chain, playing a pivotal role in oxidative phosphorylation and ATP synthesis. MT-CO2 is one of the three subunits encoded by mitochondrial DNA, which are essential for the enzyme's catalytic activity.

Structure and Function of Cytochrome c Oxidase

Cytochrome c oxidase (CcO) is a bigenomic enzyme, meaning it contains subunits encoded by both mitochondrial and nuclear DNA. In mammals, including primates like Chlorocebus aethiops, CcO consists of 13 subunits, with three catalytic subunits (I, II, and III) encoded by mitochondrial DNA . These subunits are crucial for the enzyme's function, which involves transferring electrons from cytochrome c to oxygen, producing water and generating a proton gradient that drives ATP synthesis.

Role of MT-CO2 in Mitochondrial Function

MT-CO2, as part of the cytochrome c oxidase complex, is vital for maintaining mitochondrial function. It helps in the efficient transfer of electrons and the production of ATP, which is essential for cellular energy metabolism. Any dysfunction in MT-CO2 or other subunits of cytochrome c oxidase can lead to mitochondrial disorders, characterized by impaired energy production and increased oxidative stress .

Research Findings and Applications

Research on recombinant MT-CO2 from Chlorocebus aethiops is limited, but studies on similar proteins in other species highlight their potential in understanding mitochondrial diseases and developing therapeutic strategies. For instance, mutations in mitochondrial-encoded subunits like MT-CO2 can lead to neurodegenerative diseases and metabolic disorders .

Table: Key Features of Cytochrome c Oxidase Subunits

FeatureDescription
Subunit Composition13 subunits; 3 encoded by mitochondrial DNA (I, II, III), 10 by nuclear DNA
Catalytic CentersContains heme groups (a and a3) and Cu2+ centers (CuA and CuB)
FunctionTransfers electrons from cytochrome c to oxygen, producing water and a proton gradient for ATP synthesis
Role in DiseaseDysfunction associated with mitochondrial disorders, oxidative stress, and neurodegenerative diseases

References:

- PMC: Cytochrome c Oxidase Dysfunction in Oxidative Stress
- NCBI: COX2 cytochrome c oxidase subunit II
- Cusabio: Recombinant Chlorocebus aethiops Cytochrome c oxidase subunit

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. Please inform us of any specific tag requirements for preferential development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Target Names
Target Protein Sequence
MAHPVQLGLQDATSPVMEELITFHDYALMTISLISFLVLYALFSTLTTKLTNTNITDAQE METTWTILPAVILILIALPSLRILYLTDEINNPSFTIKSIGHQWYWTYEYTDYGGLIFNS YMLPPLFLNPGDLRLLEVDNRVVLPIEAPVRMMITSQDVLHSWTIPTLGLKTDAVPGRLN QTTFTATRPGVYYGQCSEICGANHSFMPIVAELIPLKIFEMGPVFTL
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising Complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. MT-CO2 plays a crucial role in this process by participating in the reduction of oxygen to water within Complex IV. Electrons from reduced cytochrome c are transferred through the copper A center (CuA) and heme A to the binuclear center (BNC), composed of heme A3 and copper B (CuB). The BNC catalyzes the four-electron reduction of oxygen, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Cytochrome c oxidase subunit 2 in cellular respiration?

Cytochrome c oxidase subunit 2 (COX2/MT-CO2) plays a critical role in cellular respiration as a core component of mitochondrial Cytochrome c oxidase (Cco). It contains a dual core CuA active site that is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase (COX). This electron transfer is crucial for the production of ATP during cellular respiration. The protein functions within the mitochondrial electron transport chain, specifically in complex IV, where it contributes to the reduction of oxygen to water as part of the respiratory process. The electron transfer pathway begins with reduced cytochrome c in the intermembrane space, proceeds through the CuA center in subunit 2, and eventually reaches the binuclear center in subunit 1 where oxygen is reduced to water .

What are the structural characteristics of Green monkey (Chlorocebus aethiops) MT-CO2?

The Chlorocebus aethiops (Green monkey) MT-CO2 protein is cataloged under UniProt accession number P26455. As a mitochondrially-encoded protein, it exhibits high conservation across primate species while maintaining species-specific variations. The protein functions as part of the cytochrome c oxidase complex, containing binding sites for interaction with both cytochrome c and other subunits of the complex. While the complete three-dimensional structure of the isolated Green monkey MT-CO2 has not been fully characterized in the search results, recombinant versions produced for research typically represent partial protein sequences rather than the complete native form. The functional domains include electron transfer sites and membrane-spanning regions that anchor the protein in the mitochondrial inner membrane .

How does the MT-CO2 protein interact with other components of the respiratory chain?

MT-CO2 functions within the larger cytochrome c oxidase complex (Complex IV), which is one of three multisubunit complexes in the mitochondrial respiratory chain. It specifically mediates the transfer of electrons from cytochrome c to the binuclear center of the enzyme. This process involves:

  • Initial electron acceptance from reduced cytochrome c in the intermembrane space through the CuA center located in MT-CO2

  • Electron transfer to heme A in subunit 1

  • Final transfer to the binuclear center (BNC) formed by heme A3 and copper B (CuB) where oxygen reduction occurs

This electron transfer pathway is coupled to proton pumping across the mitochondrial inner membrane, contributing to the electrochemical gradient that drives ATP synthesis. MT-CO2 thus serves as a crucial interface between cytochrome c and the oxygen reduction center of the enzyme .

What expression systems are most effective for producing recombinant Chlorocebus aethiops MT-CO2?

Based on available research data, E. coli represents the most commonly used expression system for producing recombinant MT-CO2 from Chlorocebus aethiops. The prokaryotic E. coli system offers several advantages for MT-CO2 expression, including:

  • Established protocols for high-yield protein production

  • Relatively simple induction methods using IPTG

  • Well-characterized purification systems, particularly for His-tagged constructs

When expressing MT-CO2 in E. coli, researchers typically use expression vectors such as pET series vectors that contain strong T7 promoters. For example, the pET-32a vector has been successfully used for MT-CO2-related proteins. The E. coli Transetta (DE3) expression system has demonstrated effectiveness for expressing recombinant cytochrome c oxidase subunits, achieving purified protein concentrations of approximately 50 μg/mL .

For certain applications requiring post-translational modifications, eukaryotic expression systems like wheat germ extract have also been employed for cytochrome c oxidase subunits, though these are less commonly used for MT-CO2 specifically .

What are the optimal storage conditions for maintaining the stability and activity of recombinant MT-CO2?

The stability of recombinant MT-CO2 is influenced by multiple factors including storage temperature, buffer composition, and protein formulation. Based on empirical data, the following storage recommendations should be followed:

FormStorage TemperatureShelf LifeNotes
Liquid-20°C/-80°C6 monthsAvoid repeated freeze-thaw cycles
Lyophilized-20°C/-80°C12 monthsPreferred for long-term storage
Working aliquots4°CUp to 1 weekFor immediate experimental use

For optimal stability, the protein should be stored in buffer containing 5-50% glycerol (final concentration), with 50% being recommended for longer-term storage. When reconstituting lyophilized protein, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Importantly, repeated freezing and thawing should be avoided as this significantly reduces protein stability and activity. Working aliquots should be prepared and stored at 4°C for experiments conducted within a one-week timeframe .

What purification strategies yield the highest purity recombinant MT-CO2 protein?

For recombinant MT-CO2 purification, affinity chromatography using metal chelation represents the most effective initial purification step. The methodology typically involves:

  • Expression of recombinant MT-CO2 with an affinity tag (typically a 6×His-tag)

  • Cell lysis under native or denaturing conditions depending on protein solubility

  • Binding to Ni²⁺-NTA agarose resin

  • Washing to remove non-specific binding proteins

  • Elution with imidazole gradient or pH shift

This approach typically yields protein with >85% purity as determined by SDS-PAGE analysis. For applications requiring higher purity, additional purification steps such as ion exchange chromatography or size exclusion chromatography can be implemented. Western blotting using anti-His antibodies can confirm the identity and integrity of the purified protein, which for MT-CO2 fusion proteins is typically observed at approximately 44 kDa (including the tag) .

For biochemical and structural studies requiring tag-free protein, enzymatic cleavage of the affinity tag using specific proteases (such as TEV protease) can be performed, followed by a second affinity purification step to remove the cleaved tag.

How can the enzymatic activity of recombinant MT-CO2 be accurately measured?

Measuring the enzymatic activity of recombinant MT-CO2 requires assessment of its electron transfer function within the cytochrome c oxidase complex. Several methodological approaches can be employed:

  • Spectrophotometric assays: UV-spectrophotometry can be used to monitor the oxidation of reduced cytochrome c, which is catalyzed by functional cytochrome c oxidase. The decrease in absorbance at 550 nm corresponds to the oxidation of reduced cytochrome c and reflects MT-CO2 activity.

  • Oxygen consumption measurements: Since cytochrome c oxidase reduces oxygen to water, oxygen electrode-based methods can quantify activity by measuring oxygen consumption rates in the presence of reduced cytochrome c.

  • Infrared spectrometry: This technique can be used to analyze structural changes associated with substrate binding and catalytic activity of MT-CO2, providing insights into the mechanism of action.

When conducting these assays, it's important to include appropriate controls and to consider factors that may influence activity, such as the presence of specific inhibitors or enhancers. For instance, studies have shown that compounds like allyl isothiocyanate (AITC) can influence MT-CO2 activity, potentially through formation of hydrogen bonds with specific amino acid residues (e.g., Leu-31) .

What are the key considerations for designing structure-function studies of MT-CO2?

When designing structure-function studies of MT-CO2, researchers should consider several important factors:

  • Protein domain analysis: MT-CO2 contains functional domains including the CuA binding site and regions that interact with other subunits of the cytochrome c oxidase complex. Targeted mutations or truncations should be designed based on sequence conservation analysis and structural predictions.

  • Evolutionary context: MT-CO2 shows variable patterns of selection across different regions of the protein. Some codons may be under strong purifying selection (ω << 1), while others evolve under relaxed selective constraint (ω = 1) or even positive selection. This evolutionary context should inform which residues are selected for mutagenesis studies .

  • Interaction partners: MT-CO2 functions through interactions with nuclear-encoded subunits of COX and cytochrome c. Co-expression or reconstitution studies with these partner proteins can provide insights into interaction interfaces and functional dependencies.

  • Comparative approach: Using MT-CO2 proteins from different species can highlight conserved features versus species-specific adaptations. Studies have shown that interpopulation divergence at the COII locus can reach nearly 20% at the nucleotide level in some species, including numerous nonsynonymous substitutions .

  • Molecular docking: Computational approaches like molecular docking can predict binding sites for substrates or modulators. For example, docking studies have identified potential interaction points between MT-CO2 and compounds like AITC, showing specific hydrogen bonding interactions .

For point mutation studies, site-directed mutagenesis should target residues predicted to be functionally important, followed by activity assays to assess the impact of these mutations on electron transfer efficiency and protein stability.

What methods can be used to study the interaction between MT-CO2 and small molecule modulators?

Several complementary approaches can be employed to characterize the interactions between MT-CO2 and small molecule modulators:

  • Enzyme kinetics: Measuring enzymatic activity in the presence of varying concentrations of potential modulators can reveal inhibition or activation patterns and determine kinetic parameters (Ki, IC50, EC50). For example, the modulation of MT-CO2 activity by allyl isothiocyanate (AITC) has been observed through changes in its ability to catalyze cytochrome c oxidation .

  • Molecular docking: Computational techniques can predict potential binding sites and interaction modes between MT-CO2 and small molecules. This approach has identified that the sulfur atom in AITC can form a 2.9 Å hydrogen bond with Leu-31 in certain COXII proteins .

  • Thermal shift assays: These can detect changes in protein thermal stability upon ligand binding, providing evidence for direct interactions and potentially identifying stabilizing compounds.

  • Spectroscopic methods: Techniques such as circular dichroism, fluorescence spectroscopy, or infrared spectrometry can detect conformational changes in MT-CO2 upon interaction with small molecules.

  • Site-directed mutagenesis: Mutating predicted binding site residues and measuring the resulting changes in modulator effects can validate computational predictions and provide insights into the structural basis of interactions.

  • Isothermal titration calorimetry (ITC): This provides direct measurement of binding thermodynamics, including affinity constants and enthalpy changes.

When investigating potential modulators, it's important to distinguish between direct binding to MT-CO2 and indirect effects mediated through other components of the respiratory chain or cellular environment.

How does Chlorocebus aethiops MT-CO2 compare structurally and functionally with MT-CO2 from other species?

Comparative analysis of MT-CO2 across species reveals a pattern of both conservation and divergence that reflects the protein's critical role in cellular respiration while accommodating species-specific adaptations:

SpeciesKey Structural FeaturesFunctional CharacteristicsEvolutionary Pattern
Chlorocebus aethiops (Green monkey)Conserved CuA binding domain, species-specific surface residuesStandard electron transfer capabilityModerate evolution rate consistent with primates
Tigriopus californicus (Marine copepod)High interpopulation variation (up to 20% at nucleotide level)Population-specific adaptationsEvidence of both purifying and positive selection
Sitophilus zeamais (Maize weevil)227 amino acids, molecular mass of 26.2 kDa, pI value of 6.37Catalyzes cytochrome c oxidation, modulated by AITCHigh sequence identity with other insect COXII proteins
Homo sapiensEssential for complex IV assembly and functionAssociated with mitochondrial disordersBiomarker for conditions like Huntington's disease

While the core function of electron transfer from cytochrome c to the oxidase complex is preserved across species, MT-CO2 exhibits significant sequence variation that may reflect adaptation to different cellular environments or metabolic demands. In some species, such as Tigriopus californicus, MT-CO2 shows remarkable intraspecific variation between populations, with nearly 20% divergence at the nucleotide level including numerous nonsynonymous substitutions. This suggests that despite its critical role, MT-CO2 can accommodate substantial sequence variation while maintaining its core function .

The evolutionary analysis of selection patterns indicates that most codons in MT-CO2 are under strong purifying selection (ω << 1), reflecting functional constraints, while approximately 4% of sites appear to evolve under relaxed selective constraint (ω = 1). Additionally, some lineages show evidence of positive selection at specific sites, potentially reflecting adaptation to changing cellular environments or co-evolution with interacting proteins .

What insights can be gained from studying the co-evolution of MT-CO2 with nuclear-encoded respiratory chain components?

The co-evolution of mitochondrially-encoded MT-CO2 with nuclear-encoded respiratory chain components provides important insights into the mechanisms of mitonuclear compatibility and adaptation:

  • Compensatory evolution: Studies have demonstrated that high degrees of interaction between MT-CO2 and nuclear-encoded subunits of cytochrome c oxidase (COX) and cytochrome c (CYC) can drive compensatory evolution. When amino acid substitutions occur in one component, selection may favor complementary changes in interacting partners to maintain functional compatibility .

  • Hybrid incompatibility: Research in species like Tigriopus californicus has shown that interpopulation hybrids can exhibit functional and fitness consequences, likely due to mismatches between co-adapted mitochondrial and nuclear genes. This suggests that MT-CO2 evolution is constrained by the need to maintain functional interactions with nuclear-encoded partners .

  • Selection patterns: While the majority of MT-CO2 is under purifying selection, approximately 4% of sites evolve under relaxed selective constraint. Additionally, certain lineages show evidence of positive selection at specific sites, potentially reflecting adaptation to maintain compatibility with co-evolving nuclear partners .

  • Functional consequences: Branch-site maximum likelihood models have identified specific sites that may have experienced positive selection within certain population clades, consistent with experimental studies showing functional and fitness consequences among interpopulation hybrids .

These co-evolutionary dynamics have significant implications for understanding mitochondrial disorders, as mutations in MT-CO2 may have different phenotypic effects depending on the nuclear genetic background. This research area also provides insights into the mechanisms of speciation, as mitonuclear incompatibilities may contribute to reproductive isolation between diverging populations.

What role does MT-CO2 play in mitochondrial disease pathogenesis?

MT-CO2 plays a significant role in mitochondrial disease pathogenesis through multiple mechanisms:

  • Direct pathogenic mutations: Variations in the MT-CO2 gene can directly cause or contribute to mitochondrial disorders. The gene is associated with MELAS syndrome (Mitochondrial Encephalomyopathy, Lactic Acidosis, and Stroke-like episodes), a progressive neurodegenerative disorder characterized by stroke-like episodes, seizures, and lactic acidosis .

  • Respiratory chain dysfunction: As a core component of cytochrome c oxidase (Complex IV), MT-CO2 dysfunction can impair electron transport, reducing ATP production and increasing reactive oxygen species generation. This bioenergetic deficit particularly affects tissues with high energy demands such as the brain, heart, and muscle.

  • Biomarker role: MT-CO2 serves as a biomarker for conditions including Huntington's disease and stomach cancer, suggesting its involvement in diverse pathological processes beyond primary mitochondrial disorders .

  • Tissue-specific effects: The pathogenic impact of MT-CO2 mutations may vary across tissues, with particularly pronounced effects in those with high metabolic demands. This helps explain the complex, multisystem nature of many mitochondrial disorders.

  • Nuclear-mitochondrial interactions: The pathogenicity of MT-CO2 mutations can be modified by nuclear genetic background, reflecting the importance of mitonuclear interactions in determining disease expression and severity.

Understanding MT-CO2's role in disease pathogenesis has important implications for diagnostic approaches, including genetic testing for mitochondrial disorders, and potential therapeutic strategies targeting respiratory chain function or mitonuclear interactions .

How can recombinant MT-CO2 be utilized in high-throughput drug screening for mitochondrial disorders?

Recombinant MT-CO2 can serve as a valuable tool in high-throughput drug screening platforms for mitochondrial disorders through several methodological approaches:

  • Activity-based screening: Purified recombinant MT-CO2, either alone or reconstituted with other cytochrome c oxidase subunits, can be used in enzymatic assays to screen compounds that may restore or enhance electron transfer activity. The effect of compounds on cytochrome c oxidation can be monitored spectrophotometrically in a microplate format, allowing for rapid screening of large compound libraries .

  • Binding assays: Fluorescently-labeled MT-CO2 or thermal shift assays can detect direct binding of small molecules to the protein. Compounds that stabilize MT-CO2 structure or promote proper assembly with other subunits may have therapeutic potential.

  • Cell-based assays: Cell lines expressing recombinant MT-CO2 variants associated with disease can be used to screen for compounds that rescue mitochondrial function. Readouts can include ATP production, oxygen consumption, reactive oxygen species generation, or mitochondrial membrane potential.

  • Structure-guided screening: Based on molecular docking studies similar to those that identified AITC interaction with COXII, virtual screening can predict compounds likely to bind specific sites on MT-CO2. These predictions can then be validated using the biochemical approaches described above .

  • Allosteric modulator identification: Screening can target not only the active site but also potential allosteric sites that might influence MT-CO2 function or its interactions with other respiratory chain components.

This approach is particularly valuable for identifying compounds that might address mitochondrial disorders associated with MT-CO2 dysfunction, such as MELAS syndrome or other conditions where MT-CO2 serves as a biomarker, including Huntington's disease and stomach cancer .

What are the challenges and solutions in studying the assembly dynamics of MT-CO2 within the cytochrome c oxidase complex?

Studying the assembly dynamics of MT-CO2 within the cytochrome c oxidase complex presents several significant challenges with corresponding methodological solutions:

Challenges:

  • Dual genetic origin: Cytochrome c oxidase consists of subunits encoded by both mitochondrial and nuclear genomes, complicating genetic manipulation and expression studies.

  • Membrane protein nature: As components of the inner mitochondrial membrane, cytochrome c oxidase subunits including MT-CO2 are hydrophobic and difficult to work with in isolation.

  • Complex assembly process: The sequential and coordinated assembly of multiple subunits with cofactors presents technical difficulties for in vitro studies.

  • Functional assessment: Determining whether assembled complexes are functionally equivalent to native complexes requires sophisticated activity assays.

Methodological Solutions:

  • Recombinant expression systems:

    • Using E. coli or other expression systems to produce individual subunits like MT-CO2 with purification tags

    • Wheat germ cell-free expression systems for eukaryotic proteins with complex folding requirements

  • Reconstitution approaches:

    • Stepwise reconstitution of complexes from purified components in appropriate lipid environments

    • Inclusion of necessary assembly factors and chaperones identified from cellular studies

  • Advanced imaging techniques:

    • Cryo-electron microscopy to visualize assembly intermediates

    • Fluorescence resonance energy transfer (FRET) to monitor subunit interactions in real-time

  • Genetic approaches:

    • Creation of cell lines with inducible expression of tagged subunits to track assembly kinetics

    • CRISPR/Cas9 editing to introduce mutations or tags at endogenous loci

  • Activity assays:

    • Spectrophotometric assays to monitor electron transfer from cytochrome c

    • Oxygen consumption measurements to assess complete complex function

    • Site-specific probes to monitor conformational changes during assembly

These approaches allow researchers to overcome the inherent challenges in studying MT-CO2 assembly and function within the larger cytochrome c oxidase complex, providing insights into both normal assembly processes and how these might be disrupted in pathological conditions.

How can molecular dynamics simulations enhance our understanding of MT-CO2 function and dysfunction?

Molecular dynamics (MD) simulations offer powerful tools for investigating MT-CO2 at the atomic level, providing insights that are difficult to obtain through experimental methods alone:

  • Conformational dynamics: MD simulations can reveal the dynamic behavior of MT-CO2, including conformational changes associated with electron transfer, interactions with other subunits, and the effects of mutations. These simulations can identify flexible regions and stable domains that may be important for function.

  • Electron transfer mechanisms: Quantum mechanical/molecular mechanical (QM/MM) approaches can model the electron transfer process from cytochrome c through the CuA center in MT-CO2, providing insights into the electronic structures and energy landscapes that govern this critical function.

  • Mutation effects prediction: MD simulations can predict how pathogenic mutations might alter protein structure, stability, and dynamics. This is particularly valuable for understanding how seemingly minor sequence changes can lead to significant functional impairments in diseases associated with MT-CO2 dysfunction, such as MELAS syndrome .

  • Small molecule interactions: Similar to the molecular docking studies that identified potential interactions between AITC and cytochrome c oxidase subunits, MD simulations can provide detailed information about the binding modes and effects of potential drugs or modulators. These studies can reveal not just the initial binding event but also how binding affects protein dynamics over time .

  • Mitonuclear interface analysis: Simulations of the interfaces between MT-CO2 and nuclear-encoded subunits can identify key interaction residues and explain how mutations in one partner might be compensated by changes in the other, providing a molecular basis for the co-evolutionary patterns observed in population studies .

  • Membrane environment effects: As a mitochondrial membrane protein, MT-CO2 function is influenced by its lipid environment. MD simulations can model these interactions and predict how changes in membrane composition might affect protein function.

To maximize the value of MD approaches, simulation results should be validated against experimental data whenever possible, and predictions should be tested through targeted experiments such as site-directed mutagenesis and functional assays.

What are common pitfalls in recombinant MT-CO2 expression and how can they be addressed?

Researchers working with recombinant MT-CO2 often encounter several challenges during expression and purification. The following table outlines common problems and their solutions:

ChallengeCausesSolutions
Low expression levelsCodon bias, protein toxicity, improper inductionOptimize codon usage for expression host, use tightly regulated expression systems, adjust induction conditions (temperature, inducer concentration, timing)
Protein insolubilityHydrophobic regions, improper folding, absence of binding partnersExpress as fusion with solubility tags (MBP, SUMO, thioredoxin), lower induction temperature (16-20°C), add detergents or membrane mimetics
Lack of activityImproper folding, missing cofactors, incorrect post-translational modificationsInclude necessary cofactors (copper) during expression or reconstitution, consider eukaryotic expression systems, supplement growth media with 60 μM sodium tungstate for metal-dependent enzymes
Protein degradationProtease activity, protein instabilityAdd protease inhibitors during purification, maintain cold temperatures throughout handling, include stabilizing agents like glycerol
Poor purification yieldNon-specific binding, aggregation, tag interferenceOptimize imidazole concentrations in binding and wash buffers, include reducing agents if appropriate, consider alternative purification strategies

One specific consideration for MT-CO2 is the requirement for proper metal ion incorporation. For related enzymes, supplementation with specific metal ions (such as 60 μM sodium tungstate) has been shown to significantly improve recombinant enzyme production and activity. Additionally, storage conditions are critical, with recommendations including glycerol addition (5-50%) and storage at -20°C/-80°C to maintain activity, with shelf life of 6 months for liquid preparations and 12 months for lyophilized forms .

How can researchers troubleshoot inconsistent results in MT-CO2 functional assays?

When facing inconsistent results in MT-CO2 functional assays, researchers should systematically investigate potential sources of variability:

  • Protein quality assessment:

    • Verify protein purity using SDS-PAGE (>85% purity is typically required for reliable functional studies)

    • Confirm protein identity and integrity through Western blotting

    • Assess protein folding using circular dichroism or fluorescence spectroscopy

    • Check for batch-to-batch variations in expression and purification

  • Assay conditions optimization:

    • Carefully control temperature, pH, and ionic strength

    • Standardize substrate quality (reduced cytochrome c)

    • Ensure consistent oxygen levels for assays measuring oxygen consumption

    • Determine optimal protein concentration ranges where activity is linearly related to enzyme concentration

  • Cofactor considerations:

    • Verify the presence and integrity of metal cofactors, particularly copper ions for the CuA center

    • Consider supplementing reactions with metal ions if native cofactors may have been lost during purification

    • Control for the presence of inhibitors or activators that might be present in reagents

  • Control experiments:

    • Include positive controls (known active enzyme preparations)

    • Perform negative controls (heat-inactivated enzyme, samples without substrate)

    • Use reference inhibitors at known concentrations to validate assay sensitivity

  • Technical precision:

    • Standardize preparation of stock solutions and working dilutions

    • Minimize pipetting errors through technique improvement and calibration

    • Maintain consistent timing between reagent addition and measurements

    • Consider automation for critical steps to improve reproducibility

  • Data analysis:

    • Apply appropriate statistical tests to determine significance of observed differences

    • Use replicate measurements (minimum triplicate) for all experimental conditions

    • Consider normalization methods carefully to avoid introducing artificial patterns

By systematically addressing these potential sources of variability, researchers can identify the specific factors affecting their MT-CO2 functional assays and establish robust, reproducible protocols for future experiments .

What methodological approaches can overcome the challenges of studying MT-CO2 interactions with nuclear-encoded subunits?

Studying interactions between mitochondrially-encoded MT-CO2 and nuclear-encoded subunits presents unique challenges due to their different genetic origins, membrane localization, and complex assembly process. Several methodological approaches can overcome these challenges:

  • Reconstitution systems:

    • Co-expression of MT-CO2 with nuclear-encoded subunits in heterologous systems

    • Cell-free expression systems combining recombinant components in controlled environments

    • Incorporation into nanodiscs or liposomes to mimic membrane environment

    • Sequential addition of purified components to monitor assembly process

  • Advanced imaging techniques:

    • Förster Resonance Energy Transfer (FRET) using fluorescently labeled subunits to detect interactions and measure distances between components

    • Single-molecule imaging to observe assembly dynamics in real-time

    • Cryo-electron microscopy to capture structural details of subunit interactions

    • Super-resolution microscopy to visualize complex formation in cellular contexts

  • Genetic approaches:

    • Creation of cybrid cell lines combining mitochondria from one source with nuclear background from another

    • CRISPR/Cas9 editing to introduce tags or mutations in either mitochondrial or nuclear genes

    • Complementation studies in cells with MT-CO2 deficiency

    • Inducible expression systems to control the timing and stoichiometry of different subunits

  • Computational methods:

    • Molecular docking to predict interaction interfaces

    • Molecular dynamics simulations to model conformational changes during complex assembly

    • Evolutionary coupling analysis to identify co-evolving residues that likely form contacts

  • Biochemical techniques:

    • Cross-linking mass spectrometry to identify interaction points between subunits

    • Hydrogen/deuterium exchange mass spectrometry to map binding interfaces

    • Surface plasmon resonance or isothermal titration calorimetry to measure binding kinetics and thermodynamics

    • Limited proteolysis to identify protected regions that may represent interaction sites

These complementary approaches can provide a comprehensive understanding of how MT-CO2 interacts with nuclear-encoded components, offering insights into both normal assembly processes and potential dysfunction in disease states .

How might CRISPR/Cas9 technology advance the study of MT-CO2 function and disease associations?

CRISPR/Cas9 technology offers revolutionary possibilities for studying MT-CO2 function and disease associations through several innovative approaches:

  • Mitochondrial genome editing:

    • Recent advances in mitochondrial-targeted CRISPR systems (mitoTALENs, mtZFNs, and DdCBE) allow for direct editing of the mitochondrial genome

    • Introduction of disease-associated MT-CO2 mutations in cell lines and animal models

    • Creation of isogenic cell lines differing only in MT-CO2 sequence, enabling precise analysis of mutation effects

    • Correction of pathogenic mutations to establish proof-of-principle for therapeutic applications

  • Nuclear-mitochondrial interaction studies:

    • Simultaneous editing of MT-CO2 and nuclear-encoded interaction partners

    • Investigation of compensatory mutations that restore function in the presence of MT-CO2 variants

    • Creation of models to study mitonuclear compatibility and its role in disease penetrance and expressivity

  • Regulatory elements manipulation:

    • Editing of nuclear genes involved in mitochondrial gene expression and protein import

    • Modification of factors controlling MT-CO2 expression, stability, and assembly

    • Investigation of retrograde signaling pathways that respond to MT-CO2 dysfunction

  • High-throughput functional genomics:

    • CRISPR screens to identify nuclear genes that modify MT-CO2-related phenotypes

    • Systematic analysis of genetic backgrounds that exacerbate or suppress MT-CO2 dysfunction

    • Discovery of potential therapeutic targets for mitochondrial disorders

  • In vivo disease modeling:

    • Generation of animal models carrying human disease-associated MT-CO2 variants

    • Analysis of tissue-specific consequences of MT-CO2 dysfunction

    • Testing of potential therapeutic interventions in physiologically relevant contexts

These approaches could significantly advance our understanding of how MT-CO2 variations contribute to mitochondrial disorders such as MELAS syndrome, and potentially reveal new avenues for diagnostic and therapeutic development .

What potential exists for developing MT-CO2-targeted therapies for mitochondrial disorders?

The development of MT-CO2-targeted therapies for mitochondrial disorders represents an emerging frontier with several promising approaches:

  • Small molecule modulators:

    • Compounds that stabilize mutant MT-CO2 structure or enhance its assembly into functional complexes

    • Molecules that bypass impaired electron transfer through alternative pathways

    • Allosteric modulators that enhance residual enzymatic activity of mutant MT-CO2

    • Antioxidants specifically targeted to mitochondria to mitigate consequences of MT-CO2 dysfunction

  • Gene therapy approaches:

    • Allotopic expression of recoded MT-CO2 from the nuclear genome with mitochondrial targeting sequences

    • Engineered RNA import systems to deliver therapeutic RNAs to mitochondria

    • Mitochondrially-targeted nucleases for heteroplasmy shifting in cases with mixed mutant and wild-type MT-CO2

  • Protein replacement strategies:

    • Development of cell-penetrating MT-CO2 variants that can restore function in deficient cells

    • Mitochondrially-targeted peptides that enhance assembly or stability of respiratory chain complexes

    • Nanoparticle delivery systems for functional recombinant MT-CO2 protein

  • Metabolic bypass strategies:

    • Alternative electron carriers that can bypass Complex IV defects

    • Metabolic modifiers that shift energy production to glycolysis in affected tissues

    • Supplementation with metabolites downstream of the block caused by MT-CO2 dysfunction

  • Mitochondrial transplantation:

    • Transfer of healthy mitochondria containing functional MT-CO2 to cells with defective mitochondria

    • Stimulation of mitophagy to remove dysfunctional mitochondria containing mutant MT-CO2

    • Enhancement of mitochondrial biogenesis to increase the pool of functional mitochondria

These therapeutic approaches are at various stages of development, with some already in preclinical testing for mitochondrial disorders associated with MT-CO2 dysfunction, such as MELAS syndrome .

How can integrative multi-omics approaches enhance our understanding of MT-CO2 in health and disease?

Integrative multi-omics approaches offer powerful frameworks for comprehensively understanding MT-CO2 function in health and disease states by combining diverse data types:

  • Genomics integration:

    • Whole genome/exome sequencing to identify MT-CO2 variants and potential nuclear modifiers

    • Population genomics to understand natural variation and selection patterns in MT-CO2

    • Evolutionary genomics to identify conserved functional elements and species-specific adaptations

  • Transcriptomics applications:

    • RNA-seq to assess how MT-CO2 variants affect global gene expression patterns

    • Analysis of nuclear retrograde signaling in response to MT-CO2 dysfunction

    • Investigation of post-transcriptional regulation of mitochondrial gene expression

  • Proteomics contributions:

    • Quantitative proteomics to measure changes in protein abundance and post-translational modifications

    • Interactome mapping to identify the complete set of MT-CO2 protein interactions

    • Structural proteomics to characterize conformational changes associated with mutations

    • Spatial proteomics to track MT-CO2 distribution and complex assembly

  • Metabolomics insights:

    • Targeted and untargeted metabolomics to identify biomarkers of MT-CO2 dysfunction

    • Flux analysis to quantify changes in metabolic pathways affected by MT-CO2 variants

    • Correlation of metabolite levels with clinical phenotypes to identify potential therapeutic targets

  • Integration strategies:

    • Network biology approaches to connect genetic variants to protein interactions and metabolic consequences

    • Machine learning algorithms to identify patterns across multi-omics datasets

    • Systems biology modeling to predict the effects of MT-CO2 perturbations on cellular physiology

    • Longitudinal studies combining multiple omics approaches to track disease progression

This integrative approach could significantly enhance our understanding of how MT-CO2 variations contribute to conditions such as MELAS syndrome, Huntington's disease, and stomach cancer, potentially leading to improved diagnostic biomarkers and personalized therapeutic strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.