Recombinant Chlorocebus aethiops D (2) dopamine receptor

Shipped with Ice Packs
In Stock

Description

Functional Mechanisms

As a GPCR, DRD2 inhibits adenylate cyclase via G<sub>i/o</sub> proteins, reducing cAMP and modulating downstream pathways . Key signaling cascades include:

  • AKT/GSK3β Pathway: β-arrestin-mediated activation regulates synaptic plasticity and neuroprotection .

  • ERK1/2 Signaling: Linked to dendritic growth in striatal neurons .

  • Ion Channel Modulation: Coupling with GIRK channels hyperpolarizes neurons, affecting excitability .

Disease Studies

  • Parkinson’s Disease: DRD2 agonists (e.g., bromocriptine) alleviate motor symptoms by restoring dopaminergic signaling .

  • Schizophrenia: Antipsychotics target DRD2 to mitigate psychosis, though excessive blockade causes extrapyramidal side effects .

  • Cancer:

    • In breast cancer, DRD2 overexpression enhances paclitaxel sensitivity and induces apoptosis via NF-κB inhibition .

    • Glioblastoma stem cells exhibit DRD2-mediated hyperpolarization and hypoxia response activation, promoting tumorigenesis .

Drug Development

  • Structural Insights: The 6VMS structure guides the design of subtype-selective ligands .

  • High-Throughput Screening: Recombinant DRD2 is used to test antipsychotics and anti-addiction therapies .

Comparative Analysis with Orthologs

Recombinant DRD2 from Chlorocebus aethiops shares >90% sequence homology with human DRD2 in ligand-binding domains . Key differences include:

SpeciesGene NameHost SystemKey Applications
Chlorocebus aethiopsDRD2Mammalian cellsStructural studies, drug screening
Homo sapiensDRD2BaculovirusClinical pharmacology
Takifugu rubripes (Fish)drd2Cell-free expressionEvolutionary studies

Challenges in Research

  • Protein Stability: Membrane protein purification risks denaturation, requiring lipid bilayers for structural studies .

  • Signal Complexity: DRD2 activates divergent pathways (e.g., cAMP inhibition vs. ERK activation), complicating mechanistic studies .

Future Directions

  • Biased Agonism: Developing ligands that selectively activate neuroprotective over motor pathways .

  • Gene Therapy: Targeting DRD2 expression in neurodegenerative diseases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DRD2; D(2 dopamine receptor; Dopamine D2 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Target Names
Target Protein Sequence
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSKIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNADQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRSHLRAPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKNHPKIAKIFEIQTMPNGKTRTSLKTMSR RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA VNPIIYTTFNIEFRKAFLKILHC
Uniprot No.

Target Background

Function

This dopamine receptor, a G protein-coupled receptor, inhibits adenylyl cyclase. It positively regulates postnatal regression of retinal hyaloid vessels by suppressing VEGFR2/KDR activity downstream of OPN5.

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Chlorocebus aethiops D(2) dopamine receptor and how does it compare structurally to human DRD2?

Recombinant Chlorocebus aethiops D(2) dopamine receptor is a G-protein coupled receptor (GPCR) produced through recombinant expression systems, derived from the African green monkey (Chlorocebus aethiops). Like human DRD2, it belongs to the G-protein coupled receptor 1 family and functions as a dopamine receptor that inhibits adenylyl cyclase activity through coupling with Gi/o proteins . The Chlorocebus aethiops DRD2 shares high sequence homology with human DRD2, with conserved transmembrane domains and ligand-binding regions crucial for dopaminergic signaling.

Structurally, both receptors contain seven transmembrane helices characteristic of GPCRs, with palmitoylation sites required for proper plasma membrane localization and receptor stability. This palmitoylation is potentially carried out by enzymes such as ZDHHC4, ZDHHC3, and ZDHHC8 . While maintaining the core functional domains, Chlorocebus DRD2 exhibits species-specific amino acid variations that may result in subtle differences in ligand binding affinity and downstream signaling dynamics compared to the human ortholog.

What expression systems are most effective for producing functional Recombinant Chlorocebus aethiops DRD2?

Multiple expression systems have been developed for the production of functional Recombinant Chlorocebus aethiops DRD2, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesLimitationsTypical YieldBest Applications
Mammalian (HEK293)Native-like post-translational modifications, proper foldingHigher cost, longer production time0.5-2 mg/LFunctional studies, drug screening
Wheat GermCell-free system, rapid productionLimited post-translational modifications50-100 μg/mLStructural studies, antibody production
E. coliHigh yield, cost-effectiveLacks post-translational modifications, inclusion bodies formation2-5 mg/LPeptide mapping, immunization
Insect cellsGood compromise between yield and modificationsGlycosylation patterns differ from mammalian1-3 mg/LCrystallography, biophysical characterization

For functional studies requiring native-like receptor activity, mammalian expression systems are generally preferred as they facilitate proper folding and post-translational modifications essential for receptor function . Wheat germ cell-free systems have been successfully employed for producing DRD2 fragments, particularly for applications such as SDS-PAGE, ELISA, and Western blotting . When selecting an expression system, researchers should consider the intended downstream applications and the required protein quality and quantity.

What are the validated methods for assessing the functionality of recombinant Chlorocebus aethiops DRD2?

Functionality assessment of recombinant Chlorocebus aethiops DRD2 is critical to ensure that the expressed protein maintains its native properties. Multiple complementary approaches are recommended:

  • Ligand Binding Assays: Radioligand binding assays using [³H]-spiperone or [³H]-butaclamol can quantitatively determine receptor binding properties, including Kd and Bmax values . Competition binding assays with known DRD2 agonists and antagonists can confirm pharmacological specificity.

  • G-protein Coupling Assays: GTPγS binding assays measure the ability of the receptor to activate G-proteins upon dopamine stimulation. This functional readout confirms that the receptor can initiate downstream signaling cascades.

  • cAMP Inhibition Assays: Since DRD2 inhibits adenylyl cyclase activity, measuring the reduction in forskolin-stimulated cAMP production following receptor activation provides a quantitative assessment of signaling function .

  • Electrophysiological Measurements: Patch-clamp recordings in expressing cells can detect the characteristic hyperpolarization response following DRD2 activation, similar to the neuron-like hyperpolarization observed exclusively in certain cell populations .

  • Receptor Internalization Assays: Visualizing receptor trafficking following agonist stimulation using fluorescently tagged receptors confirms functionality of regulatory pathways.

Multiple validation techniques should be employed concurrently to comprehensively characterize receptor functionality, as deficiencies in one aspect of receptor function may not affect others.

How should researchers optimize expression and purification protocols for Chlorocebus aethiops DRD2 to maximize yield and functionality?

Optimizing expression and purification of Chlorocebus aethiops DRD2 requires systematic consideration of multiple parameters:

Expression Optimization:

  • Vector Selection: Vectors containing strong, inducible promoters (CMV for mammalian systems) with appropriate purification tags (His, Flag, or T7) should be selected based on downstream applications . For structural studies, Strep or Avi tags may provide better purity.

  • Cell Line Selection: For mammalian expression, stable HEK293 lines with controlled expression levels often yield more homogeneous receptor populations than transient systems. For Chlorocebus-derived proteins, Cos-7 cells (derived from Chlorocebus kidney) may provide a more compatible cellular environment.

  • Culture Conditions: Temperature reduction to 30°C after induction and addition of receptor-stabilizing ligands (such as spiperone at 1-10 μM) during expression can significantly enhance functional yields .

Purification Strategy:

  • Solubilization: A two-step detergent screening approach is recommended: first identify detergents that efficiently extract DRD2 from membranes, then screen those for preservation of ligand binding activity. DDM (n-dodecyl-β-D-maltopyranoside) at 1% with cholesteryl hemisuccinate (0.2%) often provides a good balance.

  • Affinity Purification: Tandem affinity purification using combinations of tags (e.g., His followed by Flag) significantly improves purity. Addition of 5-10 μM of a high-affinity ligand during purification helps maintain receptor stability.

  • Size Exclusion Chromatography: A final polishing step using SEC not only removes aggregates but can distinguish between monomeric and oligomeric receptor forms, which may exhibit different functional properties.

Implementation of these optimized protocols typically yields 0.5-1 mg of purified, functional receptor per liter of mammalian cell culture, representing a 3-5 fold improvement over standard methods.

What are the key considerations for designing DRD2 ligand binding studies when comparing Chlorocebus and human variants?

When designing comparative ligand binding studies between Chlorocebus aethiops and human DRD2 variants, researchers should address several critical parameters to ensure valid interpretations:

  • Equivalent Expression Levels: Normalize receptor expression across experimental systems using quantitative Western blotting or radioligand saturation binding to ensure that observed differences in ligand binding reflect intrinsic properties rather than expression artifacts .

  • Membrane Environment Standardization: Maintain consistent lipid composition in membrane preparations or reconstituted systems, as DRD2 function is significantly modulated by membrane cholesterol content and lipid microdomains. The palmitoylation of DRD2, critical for membrane localization, can affect receptor-ligand interactions and should be considered when comparing variants .

  • Comparative Binding Kinetics: Beyond equilibrium binding parameters (Kd, Bmax), assess association (kon) and dissociation (koff) rate constants, which can reveal species-specific differences in binding mechanisms. Time-resolved measurements using techniques such as surface plasmon resonance or time-resolved fluorescence provide these kinetic insights.

  • Allosteric Modulator Effects: Include studies with allosteric modulators to detect species differences in receptor conformational dynamics that may not be apparent with orthosteric ligands alone. This approach can reveal subtle structural variations between species variants.

  • Temperature Dependence Analysis: Perform binding studies at multiple temperatures (4°C, 25°C, 37°C) and construct van't Hoff plots to derive thermodynamic parameters (ΔH, ΔS), which can unmask energetic differences in binding mechanisms between species variants.

  • Competitive Displacement Panel: Utilize a diverse panel of structurally distinct competitors (including agonists, partial agonists, and antagonists) to develop a comprehensive pharmacological profile for each receptor variant. This approach generates "fingerprints" of binding site architecture that can highlight species-specific differences.

A systematic investigation incorporating these methodological considerations will provide robust comparative data on the pharmacological properties of Chlorocebus and human DRD2 variants, informing both basic receptor biology and translational applications.

How can researchers effectively investigate DRD2-mediated signaling pathway differences between Chlorocebus aethiops and human systems?

Investigating signaling pathway differences between Chlorocebus aethiops and human DRD2 requires multifaceted approaches to capture the complexity of GPCR signaling networks:

  • Bioluminescence Resonance Energy Transfer (BRET) Assays: Implement BRET-based biosensors to quantitatively measure G-protein activation kinetics and β-arrestin recruitment in real-time. These approaches can detect subtle species-specific differences in signaling preference and kinetics that may not be apparent in endpoint assays .

  • Phosphoproteomic Profiling: Employ quantitative phosphoproteomics to map signaling differences comprehensively. This approach involves:

    • Stimulating cells expressing either receptor variant with dopamine or selective agonists

    • Performing SILAC or TMT-based quantitative phosphoproteomics

    • Analyzing phosphorylation changes in key pathways (Akt-GSK3, MAPK, β-arrestin-dependent pathways)

  • Pathway-Specific Transcriptional Reporters: Develop a panel of luciferase reporters for pathways downstream of DRD2 activation (cAMP/CREB, NF-κB, NFAT, SRE) to create comprehensive signaling signatures for each receptor variant.

  • Biased Agonism Quantification: Calculate bias factors for a panel of DRD2 ligands across multiple signaling pathways to determine if species differences alter ligand bias profiles. The "operational model" of agonism can be used to derive transduction coefficients that quantify pathway-specific signaling efficacy.

  • Analysis of Receptor-Interactome Differences: Perform comparative BioID or APEX2 proximity labeling with each receptor variant to identify differences in the protein interaction networks, particularly focusing on scaffolding proteins that may direct signaling specificity.

A recent investigation examining NF-κB pathway regulation revealed that DRD2 restricts NF-κB signaling through interactions with β-arrestin2, DDX5, and eEF1A2 . This finding highlights the need to examine not only canonical G-protein pathways but also non-canonical signaling mechanisms when comparing species variants, as subtle differences in protein-protein interactions can significantly alter downstream signaling outcomes.

What advanced techniques are recommended for studying the structural dynamics of Chlorocebus aethiops DRD2 compared to other species variants?

Understanding the structural dynamics of Chlorocebus aethiops DRD2 compared to other species variants requires sophisticated biophysical approaches that can capture conformational changes under various conditions:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique provides peptide-level resolution of conformational dynamics by measuring the rate of hydrogen exchange across the protein backbone. For comparative DRD2 studies:

    • Perform parallel HDX-MS on purified Chlorocebus and human DRD2 in identical detergent/lipid environments

    • Compare exchange rates in both apo and ligand-bound states

    • Identify regions with differential dynamics that may explain species-specific pharmacological properties

  • Site-Directed Fluorescence Spectroscopy: Strategic incorporation of environmentally sensitive fluorophores at equivalent positions in Chlorocebus and human DRD2 can reveal local conformational differences:

    • Introduce cysteine mutations at conserved positions for fluorophore labeling

    • Measure changes in fluorescence intensity, emission wavelength, and anisotropy upon ligand binding

    • Quantify conformational equilibria and transition rates between active and inactive states

  • Molecular Dynamics Simulations: Conduct comparative molecular dynamics simulations to predict species-specific differences in receptor dynamics:

    • Build homology models based on available crystal structures

    • Embed receptors in explicit lipid bilayers mimicking physiological membrane composition

    • Perform microsecond-scale simulations to identify differences in conformational sampling

    • Calculate free energy landscapes for activation pathways

  • Double Electron-Electron Resonance (DEER) Spectroscopy: This advanced EPR technique measures distances between strategically placed spin labels, providing direct evidence of conformational differences:

    • Introduce pairs of spin labels at transmission switches (e.g., DRY motif-TM6)

    • Compare distance distributions between species variants in various functional states

    • Correlate structural differences with functional divergence

  • Native Mass Spectrometry: Analyze receptor-ligand complexes under near-native conditions to reveal differences in binding stoichiometry, cooperativity, and complex stability between species variants.

Recent structural studies suggest that the palmitoylation of DRD2, which can be carried out by enzymes such as ZDHHC4, ZDHHC3, and ZDHHC8, significantly affects receptor stability and membrane localization . Applying these advanced biophysical techniques to systematically compare post-translationally modified receptors would provide unprecedented insights into how structural dynamics translate to functional differences between species variants.

How can Chlorocebus aethiops DRD2 be effectively used as a model system for investigating neuropsychiatric disorder mechanisms?

Chlorocebus aethiops DRD2 offers distinct advantages as a model system for investigating neuropsychiatric disorder mechanisms, particularly when employed in sophisticated experimental paradigms:

  • Comparative Pharmacogenomics Approach: Leveraging known DRD2 polymorphisms associated with neuropsychiatric disorders (e.g., Taq1A polymorphism linked to addiction susceptibility), researchers can:

    • Generate equivalent mutations in Chlorocebus DRD2

    • Compare functional consequences across species

    • Identify conserved vs. species-specific effects on signaling

    • Determine translational relevance of findings from non-human primate models

  • Viral Vector-Mediated Expression Studies: Using viral vectors to express Chlorocebus DRD2 variants in neural cultures or in vivo models allows:

    • Assessment of receptor variants in relevant neural circuits

    • Evaluation of electrophysiological consequences of receptor activation

    • Examination of synaptic plasticity alterations

    • Investigation of neuron-glia interactions mediated by DRD2

  • Brain Organoid Models: Chlorocebus DRD2 can be studied in advanced 3D brain organoid systems to:

    • Examine receptor function in developing neural networks

    • Assess impacts on neuronal migration and circuit formation

    • Investigate gene-environment interactions on DRD2 signaling

    • Model developmental aspects of disorders like schizophrenia

  • Optogenetic and Chemogenetic Control: Combining modified Chlorocebus DRD2 with optogenetic or chemogenetic approaches enables:

    • Precise temporal control of receptor activation

    • Cell-type specific manipulation of DRD2 signaling

    • Real-time correlation of receptor activity with behavioral outputs

    • Dissection of causal relationships in disease mechanisms

The DRD2 gene has been implicated in several neuropsychiatric conditions including schizophrenia, addiction, and motor disorders like myoclonus dystonia . Studies using Chlorocebus DRD2 have provided insights into how aberrant dopaminergic signaling contributes to these conditions, particularly through its effects on adenylyl cyclase inhibition and downstream modulation of synaptic transmission . Additionally, the role of DRD2 in conferring colonization resistance via gut microbiome interactions represents an emerging area where Chlorocebus models may reveal novel mechanisms relevant to both gastrointestinal and neuropsychiatric conditions through the gut-brain axis .

What methodological approaches should be employed when studying Chlorocebus aethiops DRD2 involvement in metabolic and immune regulation?

The emerging roles of DRD2 in metabolic and immune regulation necessitate specialized methodological approaches when working with Chlorocebus aethiops models:

  • Integrated Metabolic Phenotyping: To comprehensively assess DRD2's metabolic effects, researchers should implement:

    • Hyperinsulinemic-euglycemic clamp studies to measure insulin sensitivity

    • Metabolic cage analyses for energy expenditure and substrate utilization

    • Lipidomic profiling to detect alterations in lipid metabolism

    • Glucose tolerance tests with concurrent measurement of incretin hormones

    • PET-CT imaging with appropriate tracers to assess tissue-specific metabolic activity

  • Immune Cell DRD2 Signaling Analysis: The expression of DRD2 on immune cells suggests important immunomodulatory functions that can be assessed through:

    • Flow cytometry panels that simultaneously quantify DRD2 expression and activation markers on specific immune cell subsets

    • Ex vivo stimulation assays measuring cytokine responses to DRD2 agonists/antagonists

    • ChIP-seq to identify DRD2-dependent transcriptional programs in immune cells

    • Adoptive transfer experiments with DRD2-modified immune cells to assess function in vivo

  • Gut-Immune-Brain Axis Investigation: Recent findings showing DRD2's role in colonization resistance highlight the importance of studying this receptor at the intersection of gut, immune, and neural systems :

    • Gnotobiotic models with defined microbial communities to control for microbiome effects

    • Organoid co-culture systems combining intestinal epithelial cells with immune components

    • Analysis of tryptophan metabolites that activate DRD2 in intestinal epithelium

    • Assessment of actin cytoskeletal organization in gut epithelium following DRD2 activation

    • Measurement of intestinal barrier function and bacterial translocation

  • Systems Biology Integration: The complex role of DRD2 across multiple physiological systems requires integrative approaches:

    • Multi-omics analyses (transcriptomics, proteomics, metabolomics) of tissues from models with manipulated DRD2 function

    • Network pharmacology to identify hub genes connecting DRD2 signaling to metabolic and immune pathways

    • Mathematical modeling of DRD2-dependent cross-talk between systems

Recent research has revealed that DRD2 activation by tryptophan metabolites in the intestinal epithelium decreases expression of host actin regulatory proteins involved in pathogen attachment, demonstrating a noncanonical colonization resistance pathway against attaching and effacing pathogens . This finding illustrates the importance of considering DRD2's functions beyond the nervous system when designing experiments with Chlorocebus models, particularly in contexts involving host-microbiome interactions and immune regulation.

How can researchers overcome stability and solubility challenges when working with recombinant Chlorocebus aethiops DRD2?

Maintaining stability and solubility of recombinant Chlorocebus aethiops DRD2 presents significant technical challenges that can be addressed through systematic optimization strategies:

  • Optimized Detergent Screening Protocol:

    • Implement a three-phase detergent screening approach: initial extraction efficiency, receptor stability over time, and functional retention

    • For Chlorocebus DRD2, consider combinations of primary (DDM, LMNG) and secondary detergents (CHS, GDN)

    • Quantitative stability assessments using CPM (7-diethylamino-3-(4-maleimidophenyl)-4-methylcoumarin) thermal shift assays enable high-throughput comparison of conditions

  • Strategic Construct Engineering:

    • Introduction of thermostabilizing mutations identified through alanine scanning or computational prediction

    • Fusion of stability-enhancing domains (T4 lysozyme, BRIL) at ICL3 while preserving G-protein coupling

    • Addition of minimal N-terminal modifications to block N-terminal degradation while maintaining signal peptide processing

  • Lipid Nanodisc Reconstitution:

    • Transfer purified DRD2 from detergent micelles to lipid nanodiscs composed of defined phospholipid mixtures

    • Optimize lipid composition to include cholesterol and specific phospholipids (POPC, POPE, brain lipid extracts)

    • Employ MSP (membrane scaffold protein) variants of different sizes to accommodate receptor monomers or dimers

  • Co-expression with Stabilizing Partners:

    • Co-express with β-arrestin fragments or nanobodies that stabilize specific receptor conformations

    • Include chaperone proteins (GRP78, calnexin) to enhance proper folding during biosynthesis

    • Consider co-expression of receptor-interacting proteins identified in Chlorocebus, such as specific G-protein subunits

  • Post-purification Stabilization Strategies:

    • Addition of high-affinity ligands (antagonists typically provide greater stability than agonists)

    • Glycerol (10-15%) and cholesteryl hemisuccinate (0.01-0.05%) inclusion in storage buffers

    • Flash-freezing in liquid nitrogen with trehalose (5-10%) as cryoprotectant

A key consideration specific to Chlorocebus aethiops DRD2 is the proper maintenance of palmitoylation, which is critical for receptor stability and localization to the plasma membrane . The palmitoylation process can be influenced by ZDHHC4, ZDHHC3, and ZDHHC8 enzymes . To preserve this modification, researchers should avoid strong reducing agents during purification and consider supplementation with palmitoyl-CoA in cell-free expression systems or during protein maintenance.

What strategies should researchers employ to address variability in experimental results when comparing DRD2 function across species?

Addressing variability in experimental results when comparing DRD2 function across species requires rigorous methodological controls and standardization approaches:

  • Standardized Expression System Selection:

    • Implement paired isogenic cell lines expressing either human or Chlorocebus DRD2 under identical promoters

    • Utilize site-specific integration (CRISPR-Cas9) to ensure equivalent genomic context

    • Develop fluorescence-activated cell sorting protocols to isolate populations with matched receptor densities

    • Validate equivalent subcellular localization using confocal microscopy and subcellular fractionation

  • Comprehensive Pharmacological Validation:

    • Establish complete concentration-response relationships rather than single-point measurements

    • Include standard reference compounds across all experiments as internal controls

    • Determine system-independent parameters (intrinsic efficacy, relative activities) using operational models

    • Implement "fingerprinting" approaches with diverse ligand panels to establish reliable pharmacological signatures

  • Advanced Statistical Design Considerations:

    • Perform power analyses specific to each assay type to determine appropriate sample sizes

    • Implement randomized block designs to control for batch effects

    • Use mixed-effects models to account for biological and technical sources of variation

    • Consider Bayesian approaches for complex datasets with multiple sources of variability

  • Quality Control Metrics Development:

    • Establish go/no-go criteria for experimental validity based on positive and negative controls

    • Implement standardized receptor expression quantification using calibrated Western blots

    • Develop validated functional assay controls with defined acceptable ranges

    • Create standard operating procedures with decision trees for troubleshooting variability

  • Advanced Data Integration Approaches:

    • Employ multivariate analyses to identify patterns across multiple parameters

    • Develop machine learning algorithms to classify responses and identify outliers

    • Implement Bayesian hierarchical modeling to integrate data across experiments

    • Create quantitative systems pharmacology models to account for species differences in signaling networks

Research with DRD2 has shown that even small variations in experimental conditions can significantly impact observed signaling outcomes. For instance, the involvement of DRD2 in regulating NF-κB signaling through interaction with β-arrestin2, DDX5, and eEF1A2 demonstrates the complexity of receptor-mediated pathways that must be carefully controlled when comparing across species . Similarly, the discovery that DRD2 can be activated by tryptophan metabolites to influence actin cytoskeletal organization in intestinal epithelium highlights how tissue context and environmental factors must be standardized for meaningful cross-species comparisons .

What emerging technologies will advance our understanding of Chlorocebus aethiops DRD2 structure-function relationships?

Emerging technologies are poised to revolutionize our understanding of Chlorocebus aethiops DRD2 structure-function relationships, enabling unprecedented insights at multiple levels of biological organization:

  • Cryo-Electron Microscopy Advances:

    • Single-particle cryo-EM with improved detectors now achieves sub-2Å resolution for membrane proteins

    • Application to DRD2 will reveal species-specific structural features, particularly in the ligand-binding pocket and G-protein coupling interface

    • Time-resolved cryo-EM can potentially capture conformational transitions during receptor activation

    • Focused refinement techniques will allow visualization of flexible regions often missing in crystal structures

  • Integrative Structural Biology Approaches:

    • Combining cryo-EM with molecular dynamics, HDX-MS, and NMR to develop complete models of receptor dynamics

    • Cross-linking mass spectrometry to map interaction interfaces between DRD2 and signaling partners

    • Ion mobility mass spectrometry to characterize conformational ensembles of purified receptors

    • Small-angle X-ray and neutron scattering to analyze receptor-detergent or receptor-nanodisc complexes

  • Advanced Genetic and Genomic Technologies:

    • Base editing and prime editing for precise modification of Chlorocebus DRD2 without double-strand breaks

    • CRISPR activation/interference systems to modulate endogenous receptor expression

    • Single-cell multiomics to correlate receptor expression with transcriptional, epigenetic, and proteomic profiles

    • Spatial transcriptomics to map DRD2 expression and signaling outputs across tissue microenvironments

  • Artificial Intelligence and Computational Approaches:

    • Deep learning models (AlphaFold, RoseTTAFold) for accurate prediction of species-specific structural features

    • Molecular dynamics with enhanced sampling techniques to model conformational landscapes

    • Graph neural networks to predict species differences in protein-protein interaction networks

    • Quantum mechanical calculations for accurate modeling of ligand binding energetics

  • Advanced Imaging Technologies:

    • Single-molecule imaging with improved fluorophores to track DRD2 dynamics in living cells

    • Lattice light-sheet microscopy for 3D visualization of receptor trafficking and clustering

    • Expansion microscopy for super-resolution imaging of DRD2 within signaling nanodomains

    • Correlative light and electron microscopy to relate receptor distribution to cellular ultrastructure

  • Synthetic Biology and Bioengineering:

    • Engineered DRD2 variants with incorporated biosensors to report conformational changes

    • Synthetic cells with reconstituted DRD2 signaling pathways in controlled environments

    • Microfluidic systems for high-throughput analysis of receptor pharmacology

    • Organ-on-chip technologies incorporating DRD2-expressing cells in physiologically relevant contexts

The continued development of these technologies will address key questions about DRD2 function, including how structural differences between species influence ligand recognition, G-protein coupling selectivity, β-arrestin recruitment, and interaction with regulatory proteins like those involved in palmitoylation (ZDHHC4, ZDHHC3, and ZDHHC8) . These technological advances will also help elucidate the molecular mechanisms underlying DRD2's diverse physiological roles, from canonical neurotransmission to newly discovered functions in colonization resistance and immune regulation .

How might comparative studies of Chlorocebus aethiops and human DRD2 inform precision medicine approaches for neuropsychiatric disorders?

Comparative studies of Chlorocebus aethiops and human DRD2 have significant potential to inform precision medicine approaches for neuropsychiatric disorders through several innovative research avenues:

  • Pharmacogenomic Translation Models:

    • Systematic comparison of how genetic variants affect receptor function across species

    • Development of predictive algorithms that translate non-human primate drug responses to expected human outcomes

    • Identification of conserved vs. species-specific pharmacogenetic markers for treatment response

    • Creation of cellular models expressing patient-specific and Chlorocebus variant receptors for parallel drug screening

  • Signaling Pathway Resolution for Target Identification:

    • Comparative phosphoproteomic mapping of signaling cascades activated by both receptors

    • Identification of differential protein-protein interactions that could serve as novel therapeutic targets

    • Analysis of pathway differences that contribute to species-specific side effect profiles

    • Development of biased ligands that selectively activate beneficial pathways identified through cross-species comparison

  • Advanced Disease Modeling Approaches:

    • Creation of "humanized" Chlorocebus models expressing human DRD2 variants associated with specific disorders

    • Development of patient-derived organoids alongside Chlorocebus organoids for comparative drug screening

    • Single-cell transcriptomic analysis of DRD2-expressing cells across species to identify disease-relevant gene modules

    • Longitudinal imaging studies correlating receptor function with circuit-level and behavioral outcomes

  • Precision Biomarker Development:

    • Identification of species-conserved signaling metabolites that could serve as clinical biomarkers

    • Development of PET ligands with enhanced specificity for particular receptor conformational states

    • Creation of functional assays that predict individual treatment responses based on ex vivo testing

    • Identification of microbiome signatures associated with DRD2 function across species

  • Integrative Multimodal Approaches:

    • Combination of neuroimaging, electrophysiology, and molecular assays to create comprehensive functional profiles

    • Development of computational models that integrate data across biological scales and species

    • Application of network medicine approaches to position DRD2 within disorder-specific molecular networks

    • Implementation of digital phenotyping alongside molecular characterization for comprehensive phenotyping

The recent discovery that DRD2 plays unexpected roles outside the nervous system, such as in gut epithelial function and colonization resistance , suggests that comparative studies may uncover additional non-canonical functions relevant to comorbidities frequently observed in neuropsychiatric disorders. For instance, the interaction between DRD2 and the microbiome-gut-brain axis could explain the high comorbidity between gastrointestinal disorders and conditions like depression, anxiety, and autism spectrum disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.