Recombinant Chlorocebus aethiops Diacylglycerol O-acyltransferase 1 (DGAT1)

Shipped with Ice Packs
In Stock

Description

Introduction

Diacylglycerol O-acyltransferase 1 (DGAT1) is an enzyme that catalyzes the final step in triacylglycerol (TAG) synthesis, a crucial process for energy storage in organisms . Specifically, Recombinant Chlorocebus aethiops DGAT1 refers to a version of this enzyme that has been produced using recombinant DNA technology, with the gene originating from the Chlorocebus aethiops, also known as the green monkey .

DGAT1 Function and Activities

DGAT1 is an acyl CoA:diacylglycerol acyltransferase enzyme . It facilitates the synthesis of triacylglycerols by catalyzing the addition of an acyl group to diacylglycerol (DAG) . Apart from its primary function, DGAT1 can also exhibit other acyltransferase activities in vitro, such as acyl CoA:monoacylglycerol acyltransferase (MGAT), wax monoester and wax diester synthases, and acyl CoA:retinol acyltransferase (ARAT) . These activities are involved in synthesizing diacylglycerols, wax esters, and retinyl esters, respectively .

DGAT1 Isozymes and Their Significance

The DGAT family consists of two known enzymes, DGAT1 and DGAT2, which are encoded by unrelated genes . While both DGAT1 and DGAT2 contribute to triacylglycerol synthesis, they exhibit different phenotypes when knocked out in mice, suggesting functional differences . DGAT1 is highly conserved among species, including goats, sheep, and cattle, with minimal differences observed in their DGAT1 protein sequences .

Recombinant Production and Characteristics

Recombinant Chlorocebus aethiops DGAT1 is produced using in vitro expression systems, such as E. coli . The recombinant protein is available from commercial sources, with varying storage conditions and shelf lives depending on its form (liquid or lyophilized) . The molecular characterization of DGAT1 has been explored through heterologous expression in different organisms, like Yarrowia lipolytica, revealing its substrate specificities and localization to the endoplasmic reticulum, where TAG biosynthesis occurs .

DGAT1 in Lipid Improvement

Studies involving site-directed mutagenesis of DGAT1 have identified essential amino acids that affect its function, offering insights into the structure-function relationship of the enzyme . For instance, modifying specific amino acids in Chlorella ellipsoidea DGAT1 (CeDGAT1) can significantly impact total fatty acid and triacylglycerol contents . These findings suggest the potential use of modified DGAT1 genes for lipid improvement in microalgae and plants .

DGAT1 and Milk Traits

The DGAT1 gene is a candidate gene for milk traits in dairy animals, including buffaloes, cattle, and goats . Variations in the DGAT1 gene have been associated with differences in milk yield and composition in dairy goats, indicating its importance in selecting animals with desired milk characteristics .

DGAT1 Activity in Plants

Studies have explored the effectiveness of DGAT1 from various plant species in promoting TAG accumulation in Arabidopsis and yeast . DGAT1s from Vernonia, sunflower, Jatropha, and sesame have shown significantly higher TAG content compared to DGAT1s from Arabidopsis, castor, and soybean . Specific amino acid substitutions in DGAT1 can substantially increase TAG content, highlighting the potential for enhancing oil production through DGAT1 engineering .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DGAT1; DGAT; Diacylglycerol O-acyltransferase 1; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-491
Protein Length
full length protein
Species
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Target Names
DGAT1
Target Protein Sequence
MGDRGGAGGTRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDMGAAGDAPAPAPSKDADD GVASGHWELRCHRLQDSLFSSDSGFNNYRGILNWCVVMLILSNARLFLENLIKYGILVDP IQVVSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILC FPAAVVLLVESITPVGSLLALMVHTILFLKLFSYRDVNLWCRRARAKAASAGKRASSAAA PHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQ QWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGD REFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSRWMARIGVFLASAFFHEY LVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLTLIIGQPIAVLMYVHDYY VLNYEAPVAGA
Uniprot No.

Target Background

Function
Diacylglycerol O-acyltransferase 1 (DGAT1) catalyzes the final and irreversible step in triacylglycerol synthesis, utilizing diacylglycerol and fatty acyl CoA as substrates. It is highly expressed in small intestinal epithelial cells and is crucial for dietary fat absorption. In the liver, DGAT1 esterifies exogenous fatty acids to glycerol, synthesizing fat for storage. It is also present in mammary glands, contributing to milk fat production. DGAT1 may participate in very low density lipoprotein (VLDL) assembly. Unlike DGAT2, it is not essential for survival. DGAT1 functions as the primary acyl-CoA retinol acyltransferase (ARAT) in the skin, maintaining retinoid homeostasis and preventing retinoid toxicity-related skin and hair disorders. It exhibits additional acyltransferase activities, including acyl CoA:monoacylglycerol acyltransferase (MGAT) and wax monoester and diester synthase activities. Furthermore, DGAT1 can utilize 1-monoalkylglycerol (1-MAkG) as an acyl acceptor, synthesizing monoalkyl-monoacylglycerol (MAMAG).
Protein Families
Membrane-bound acyltransferase family, Sterol o-acyltransferase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is DGAT1 and what is its primary function?

DGAT1 (Diacylglycerol O-acyltransferase 1) is an enzyme that catalyzes the final committed step in triglyceride biosynthesis. It is responsible for the esterification of diacylglycerol with fatty acyl-CoA to form triacylglycerol, which is essential for lipid droplet formation. DGAT1 is expressed in various tissues, with particularly important roles in adipose tissue, intestine, and liver. The enzyme is also known by several other names including ARGP1, DGAT, ARAT (Acyl-CoA retinol O-fatty-acyltransferase), and ACAT-related gene product 1 .

From a structural perspective, DGAT1 is an integral membrane protein primarily localized to the endoplasmic reticulum lumen. In primates such as Chlorocebus aethiops, DGAT1 shares significant homology with human DGAT1, though species-specific differences in post-translational modifications may affect its enzymatic activity and regulation in experimental contexts .

Where is DGAT1 localized in cells and how does this affect its function?

DGAT1 is predominantly localized to the endoplasmic reticulum (ER) lumen as an integral membrane protein. Its subcellular location is critical for its function in lipid metabolism . While primarily associated with the ER, DGAT1 activity has also been reported in association with lipid droplets (LDs), which may result from DGAT1 remaining in the LDs after they have pinched off from the ER .

The topology of DGAT1 includes a hydrophilic N-terminus that extends into the cytosol, followed by multiple transmembrane domains that anchor the protein in the ER membrane. This orientation positions the active site to facilitate the transfer of acyl groups from acyl-CoA to diacylglycerol, thereby completing the final step in triglyceride synthesis. The N-terminal region of DGAT1 has been shown to influence the accumulation of both recombinant protein and lipids in experimental systems, suggesting it plays a regulatory role in enzymatic function .

How do DGAT1 knockout models differ phenotypically from wild-type?

DGAT1 knockout models exhibit several distinct phenotypic differences compared to wild-type organisms. In mouse models, DGAT1 null mice demonstrate:

  • Resistance to diet-induced obesity

  • Enhanced insulin sensitivity

  • Abnormalities in skin development and function

  • Altered lipid metabolism and reduced triglyceride accumulation

These phenotypic differences highlight the critical role of DGAT1 in energy homeostasis and lipid metabolism. Interestingly, in cellular models of viral infection, DGAT1 knockout or silenced cells show approximately 4-5 fold higher yields of rotavirus compared to wild-type cells, revealing a potential role for DGAT1 in viral pathogenesis .

PhenotypeDGAT1 Wild-TypeDGAT1 Knockout
Diet-induced obesitySusceptibleResistant
Insulin sensitivityNormalEnhanced
Skin developmentNormalAbnormal
Triglyceride accumulationNormalReduced
Rotavirus yieldBaseline4-5 fold increase

How does the N-terminal domain of DGAT1 influence enzyme activity and protein stability?

The N-terminal domain of DGAT1 plays a critical role in modulating both enzyme activity and protein stability. Research with chimeric DGAT1 constructs has demonstrated that the N-terminus influences the long-term accumulation of both recombinant protein and lipids in expression systems .

Specifically, when reciprocal chimeric DGAT1s from various species were generated, it was observed that related N-termini had similar effects (either positive or negative) on the accumulation of recombinant protein. This suggests that the N-terminal region contains regulatory elements that control DGAT1 stability and function across species .

The variable portion of the DGAT1 N-terminus consists of a hydrophilic head of variable length that has been characterized as an intrinsically disordered region. This is followed by a relatively short region of increased similarity and then a highly conserved acyl-CoA binding site spanning exons 1 and 2. The variability in the N-terminal region between species appears to be confined primarily to the first exon, which may represent an evolutionary mechanism that allows for species-specific regulation of enzyme activity while maintaining the core catalytic function .

What are the experimental considerations when expressing recombinant DGAT1 in heterologous systems?

When expressing recombinant DGAT1 in heterologous systems, several critical experimental considerations must be addressed:

  • Expression System Selection: Prokaryotic expression systems like E. coli may be suitable for producing fragments of DGAT1, but eukaryotic systems may be necessary for full-length, properly folded enzyme. For Chlorocebus aethiops DGAT1, mammalian expression systems might yield protein with more native-like properties compared to bacterial systems .

  • Protein Topology and Membrane Integration: As an integral membrane protein, DGAT1 requires proper insertion into the ER membrane for function. Expression constructs should preserve transmembrane domains and topological orientation .

  • N-terminal Design: The N-terminus significantly affects protein accumulation and stability. Consider using chimeric constructs or optimized N-terminal sequences if protein yield is insufficient .

  • Purification Strategy: DGAT1 typically requires detergent solubilization for extraction from membranes. For recombinant versions, affinity tags like His-tags can facilitate purification while minimizing interference with enzyme function .

  • Protein Degradation Management: DGAT1 is susceptible to proteolytic degradation, resulting in multiple C-terminal fragments. These degradation patterns are specific to each DGAT1 variant and may affect experimental reproducibility. Protease inhibitors should be included in all buffers during isolation .

  • Storage Conditions: Recombinant DGAT1 stability is optimized when stored at -80°C as aliquots to avoid repeated freeze/thaw cycles. For short-term storage (up to one month), 2-8°C is acceptable. Reconstitution should be performed in buffer systems like PBS (pH 7.4) to a concentration of 0.1-1.0 mg/mL, with careful avoidance of vortexing .

How do DGAT1 inhibitors differ in their tissue distribution and what implications does this have for experimental design?

DGAT1 inhibitors exhibit distinct tissue distribution patterns that significantly impact their experimental effects and potential therapeutic applications. Research has identified at least two categories of DGAT1 inhibitors with different distribution properties:

  • Systemic Distribution Inhibitors: Compounds like "Compound A" (referenced in Japan Tobacco patent applications) distribute broadly throughout various tissues. While these inhibitors effectively block DGAT1 activity in multiple organs, they tend to cause skin aberrations similar to those observed in DGAT1 knockout models. This systemic distribution creates potential confounding variables in metabolic studies .

  • Intestine-Targeted Inhibitors: Compounds like "Compound B" (A-922500, reported by Abbott Laboratories) preferentially distribute to intestinal tissues. These inhibitors demonstrate improved specificity for blocking intestinal DGAT1 activity while minimizing effects on skin and other tissues. This selective distribution profile allows for tissue-specific interrogation of DGAT1 function .

When designing experiments utilizing DGAT1 inhibitors, researchers should consider:

  • The tissue specificity required for the experimental question

  • Potential off-target effects in non-targeted tissues

  • Pharmacokinetic considerations including absorption, distribution, and half-life

  • The concordance between inhibitor effects and genetic models (knockouts/knockdowns)

The following table summarizes key differences between systemic and intestine-targeted DGAT1 inhibitors:

PropertySystemic InhibitorsIntestine-Targeted Inhibitors
Tissue distributionBroadPreferential to intestine
Skin aberrationsPresentAbsent
Effects on obesityImprovedImproved
Effects on insulin resistanceImprovedImproved
Experimental applicationsBroad DGAT1 inhibition studiesIntestine-specific DGAT1 studies

What are the recommended protocols for reconstituting and storing recombinant DGAT1?

Optimal reconstitution and storage of recombinant DGAT1 proteins requires careful attention to buffer composition, temperature, and handling to maintain enzymatic activity. Based on established protocols for recombinant DGAT1 proteins, the following methodological approach is recommended:

Reconstitution Protocol:

  • Ensure the lyophilized recombinant DGAT1 powder reaches room temperature before opening the vial

  • Reconstitute in 10mM PBS (pH 7.4) to a final concentration of 0.1-1.0 mg/mL

  • Allow complete dissolution by gentle swirling or rotation – do not vortex as this may cause protein denaturation

  • For experimental applications requiring higher enzymatic activity, consider including 0.01% of a suitable detergent in the reconstitution buffer to maintain the native conformation of the membrane protein

Storage Recommendations:

  • Short-term storage (up to one month): 2-8°C in the reconstitution buffer

  • Long-term storage (up to 12 months): -80°C as single-use aliquots

  • Avoid repeated freeze/thaw cycles as these significantly reduce protein stability and activity

  • For each experimental use, thaw only the required amount of protein to minimize degradation

Stability Assessment:
The thermal stability of recombinant DGAT1 can be monitored via accelerated thermal degradation testing. When properly stored, high-quality recombinant DGAT1 preparations should exhibit less than 5% loss rate when incubated at 37°C for 48 hours. Any precipitation or obvious degradation indicates compromised protein quality .

How can researchers effectively evaluate DGAT1 enzymatic activity in vitro?

Evaluating DGAT1 enzymatic activity requires specialized assays that account for the hydrophobic nature of both the enzyme and its substrates. Several methodological approaches can be employed:

Radiometric Assay:

  • Prepare reaction mixture containing diacylglycerol, radiolabeled [14C]acyl-CoA, phospholipids, and appropriate buffer

  • Initiate reaction by adding purified DGAT1 or DGAT1-containing microsomes

  • Incubate at 37°C for 5-30 minutes

  • Terminate reaction with organic solvents (chloroform:methanol)

  • Separate reaction products by thin-layer chromatography

  • Quantify radiolabeled triacylglycerol formation by scintillation counting

Fluorescence-Based Assay:

  • Utilize diacylglycerol and fluorescently labeled acyl-CoA analogs

  • Monitor the increase in fluorescence as the reaction proceeds

  • This approach offers real-time monitoring capabilities without radioactivity

Coupled Enzyme Assay:

  • Measure CoA release during the DGAT1 reaction

  • Couple CoA production to a secondary enzyme reaction that produces a spectrophotometrically detectable product

  • Monitor absorbance changes at appropriate wavelengths

When evaluating DGAT1 activity, researchers should also consider:

  • The impact of detergents on enzyme activity, as these can both solubilize the enzyme and potentially interfere with the assay

  • The importance of appropriate controls including heat-inactivated enzyme preparations

  • The need for protein concentration normalization, particularly when comparing different DGAT1 variants or experimental conditions

What cloning strategies are most effective for generating DGAT1 expression constructs?

Successful cloning and expression of DGAT1 requires strategic approaches that account for its membrane protein nature and regulatory elements. Based on published methodologies, the following strategies are recommended:

Vector Selection:
Select expression vectors with appropriate promoters based on the host system. For yeast expression, vectors with galactose-inducible promoters (like GAL1 in pYES2.1) have been successfully employed. For mammalian expression, vectors with strong constitutive promoters (CMV) or inducible systems may be appropriate .

Amplification Strategy:

  • Design primers that incorporate convenient restriction sites to facilitate subcloning

  • When amplifying Chlorocebus aethiops DGAT1, primer design should account for regions of high sequence conservation

  • Consider codon optimization for the expression host to improve protein yield

  • Example primer approach (based on Arabidopsis DGAT1 methodology):

    • Forward: 5'-GCCGCATTTAATTAAGAATTC-3' (incorporating EcoRI site)

    • Reverse: 5'-GGCAGACATAGAACCCTTTCTA-3' (incorporating XbaI site)

Fusion Tags:
Adding appropriate tags facilitates both detection and purification:

  • C-terminal tags (V5:6×His) are generally preferred over N-terminal tags to avoid interference with the regulatory N-terminal domain

  • Confirm tag incorporation doesn't disrupt membrane topology

  • Verify construct integrity by restriction mapping and DNA sequencing

Chimeric Constructs:
For investigating domain-specific functions:

  • Utilize restriction sites within the coding sequence to exchange domains between DGAT1 variants

  • XhoI and XbaI sites have been successfully used to exchange fragments between different parent constructs

  • When creating N-terminal variants, preserve the conserved acyl-CoA binding domain (containing the LSS sequence)

Truncation Constructs:
When studying specific domains:

  • For N-terminal truncations, replace the native N-terminus with a short linker (e.g., MGGGS) followed by sequences immediately upstream of conserved regions

  • Maintain reading frame and ensure proper folding potential

How should researchers interpret unexpected molecular weight observations in DGAT1 SDS-PAGE analysis?

Researchers frequently observe discrepancies between predicted and apparent molecular weights when analyzing DGAT1 by SDS-PAGE. This "gel shifting" phenomenon is common for membrane proteins and requires careful interpretation:

Common Observations and Explanations:

  • Faster Migration (15-20% lower apparent MW): DGAT1 typically migrates 15-20% faster than predicted based on amino acid sequence. This gel shifting is characteristic of membrane proteins due to their hydrophobicity, which causes increased SDS binding per amino acid compared to soluble proteins .

  • Multiple Bands Pattern: The appearance of multiple small discrete immunoreactive bands when probing with anti-tag antibodies indicates the presence of C-terminal DGAT1 fragments. These represent degradation intermediates of the protein and show patterns specific to each DGAT1 variant .

  • High MW Bands: In some preparations, particularly from lipid droplet fractions, DGAT1 may appear as large oligomers that resist denaturation under standard SDS-PAGE conditions. These may represent homo- or hetero-oligomeric complexes that are functionally relevant .

Interpretation Guidelines:

  • Compare migration patterns between different DGAT1 constructs under identical conditions rather than relying on absolute MW markers

  • Use multiple detection methods (e.g., different antibodies targeting different epitopes) to confirm band identity

  • Consider the influence of post-translational modifications on migration patterns

  • For quantitative comparisons, account for the potential impact of N-terminal regions on protein stability and detection sensitivity

What factors influence recombinant DGAT1 stability and how can degradation be minimized?

Recombinant DGAT1 stability is influenced by multiple factors that researchers must address to minimize degradation and maximize experimental reproducibility:

Critical Stability Factors:

  • N-terminal Composition: The N-terminal region significantly impacts long-term protein stability. Different N-termini from related DGAT1 proteins can have either positive or negative effects on protein accumulation. When designing constructs, consider using N-terminal sequences known to enhance stability .

  • Expression System Considerations: The expression host influences post-translational processing and degradation pathways. In yeast expression systems using the GAL1 promoter, recombinant protein typically declines at stationary phase, affecting long-term accumulation .

  • Membrane Environment: As an integral membrane protein, DGAT1 stability depends on proper membrane integration. Detergent selection during extraction and purification is critical for maintaining native conformation.

  • Proteolytic Degradation: DGAT1 is susceptible to proteolytic processing, resulting in characteristic C-terminal fragment patterns. While most degradation appears independent of the N-terminus, certain chimeric constructs show unique degradation profiles .

Stability Optimization Strategies:

  • Buffer Formulation: Utilize PBS (pH 7.4) containing protective additives such as 0.01% SKL and 5% Trehalose. These components help maintain protein integrity during storage and freeze/thaw cycles .

  • Temperature Control: Store aliquoted protein at -80°C for long-term preservation. For working stocks, limit storage at 2-8°C to one month maximum .

  • Protease Inhibition: Include a comprehensive protease inhibitor cocktail during all extraction, purification, and handling steps to minimize degradation.

  • Freeze/Thaw Management: Prepare single-use aliquots to eliminate repeated freeze/thaw cycles, which significantly accelerate degradation .

  • Thermal Stability Assessment: Monitor protein quality using accelerated thermal degradation testing. Well-preserved DGAT1 should show less than 5% degradation after 48 hours at 37°C .

How can contradictory research findings regarding DGAT1 function be reconciled in experimental designs?

Contradictory findings in DGAT1 research require careful experimental design to reconcile discrepancies. A methodical approach to addressing such contradictions includes:

Analysis of Conflicting Data:

One notable contradiction appears in rotavirus infection studies, where one report indicated silencing DGAT1 resulted in a 1.4-fold decrease in virus yield, while more recent data demonstrated a 4-5 fold increase in virus yield in DGAT1-silenced or knockout cells . Such contradictions may arise from:

  • Methodological Differences: Variations in silencing efficiency, cell types, virus strains, or quantification methods

  • Temporal Considerations: Different time points of analysis post-infection

  • Compensatory Mechanisms: Upregulation of alternative pathways (such as DGAT2) in chronic vs. acute DGAT1 deficiency

  • Cell Type-Specific Effects: Varying roles of DGAT1 in different tissues or cell lineages

Reconciliation Strategies:

  • Comprehensive Controls: Include multiple control conditions that account for different variables:

    • Wild-type cells

    • Knockout/knockdown cells

    • Knockout cells with re-expressed DGAT1

    • Pharmacological inhibition alongside genetic approaches

  • Multi-methodological Approach: Employ both genetic (siRNA, CRISPR) and pharmacological (inhibitors) approaches to target DGAT1, comparing outcomes across methodologies:

    ApproachAdvantagesLimitations
    siRNA KnockdownRapid implementation, tunableIncomplete silencing, off-targets
    CRISPR KnockoutComplete elimination of proteinPotential compensation, clonal effects
    Chemical InhibitionDose-dependent, reversiblePotential off-target effects
    Domain MutationsTarget specific functionsMay alter protein stability
  • Time-course Analysis: Examine DGAT1-dependent processes across multiple time points to distinguish between acute and chronic effects.

  • Cross-species Validation: Test hypotheses across multiple species or cell types to identify conserved vs. context-specific functions.

  • Combinatorial Approaches: When studying complex phenotypes like metabolic effects, combine in vitro cellular studies with in vivo models to better understand systemic impacts.

What are the emerging applications of DGAT1 in understanding viral pathogenesis?

Recent research has revealed surprising connections between DGAT1 and viral pathogenesis, particularly for enteric viruses. These findings open new avenues for understanding virus-host interactions and potential therapeutic interventions:

DGAT1 in Rotavirus Infection:

Rotavirus (RV), a major cause of severe diarrhea, has been shown to induce and require lipid droplets (LDs) to assemble virus replication factories. Paradoxically, RV infection leads to the degradation of DGAT1, which is essential for triacylglycerol synthesis and LD formation .

The loss of DGAT1 during infection has significant implications:

  • Decreased expression of key nutrient and ion transporters

  • Reduced expression of junctional proteins required for normal enterocyte function

  • Contribution to the pathophysiological mechanism of RV-induced malabsorptive diarrhea

Interestingly, DGAT1 silencing or knockout results in increased virus yields (4-5 fold higher than controls), suggesting complex regulatory relationships between lipid metabolism and viral replication .

Research Opportunities:

  • Mechanistic Studies: Investigating how RV mediates DGAT1 degradation and how this process benefits viral replication despite its apparent requirement for LDs

  • Therapeutic Potential: Exploring whether modulation of DGAT1 activity could serve as a novel antiviral strategy, particularly against enteric viruses

  • Broader Viral Connections: Determining whether other viruses also exploit DGAT1 and lipid metabolism pathways for replication and pathogenesis

  • Host-Pathogen Interface: Understanding how viral manipulation of lipid metabolism contributes to disease manifestations beyond direct cytopathic effects

How might species-specific differences in DGAT1 structure affect comparative research?

Species-specific variations in DGAT1 structure have significant implications for comparative research and the translation of findings across experimental models:

Evolutionary Patterns in DGAT1:

Analysis of plant DGAT1 has revealed that the N-terminal regions show considerable variability between species, while the catalytic domains remain highly conserved. In some plant families, phylogenetic analysis groups DGAT1 peptide sequences encoded by exon 1 into clades corresponding with taxonomic family . Similar patterns likely exist among mammalian DGAT1 orthologs, including differences between human and Chlorocebus aethiops DGAT1.

Functional Implications of Structural Differences:

When reciprocal chimeric DGAT1s were created by exchanging domains between species, the N-terminal region was found to significantly influence protein accumulation and lipid production. This suggests that species-specific differences in the N-terminus may confer adaptive advantages related to lipid metabolism in different organisms .

Experimental Considerations:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.