Recombinant Chlorocebus aethiops Gap junction alpha-1 protein (GJA1)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

Recombinant Chlorocebus aethiops GJA1 is generated through heterologous expression systems (e.g., E. coli, mammalian cells) to produce the full-length or truncated protein for biochemical and functional studies . GJA1 is a 43 kDa protein that forms hexameric connexons, which dock between adjacent cells to create gap junction channels. These channels facilitate intercellular communication by allowing the passage of ions, metabolites, and signaling molecules ≤1.5 kDa .

Production and Purification

Recombinant Chlorocebus aethiops GJA1 is typically expressed in E. coli or mammalian systems (e.g., HEK293) with affinity tags (e.g., His, Myc) for purification . For example:

Example Production Workflow

  • Expression System: E. coli

  • Tag: N-terminal His-tag

  • Purification: Affinity chromatography (e.g., Ni-NTA), size exclusion chromatography

  • Purity: >90% (verified by SDS-PAGE)

  • Storage: Lyophilized in Tris/PBS buffer with trehalose; stable at -80°C

Key Roles in Cellular Processes

  • Intercellular Communication: Facilitates electrical coupling in cardiac tissue and metabolic coordination .

  • Microtubule Interaction: Binds tubulin via its C-terminal domain, anchoring microtubules to gap junctions .

  • Ciliogenesis: Regulates primary and motile cilia formation by interacting with Rab11 and CP110 during vesicle trafficking .

  • Mitochondrial Protection: Truncated isoform GJA1-20k (translated from internal methionine) localizes to mitochondria, enhancing biogenesis and reducing ROS during ischemia .

Disease Relevance

  • Cardiac Malformations: Mutations in GJA1 correlate with arrhythmias and hypoplastic left heart syndrome .

  • Oculodentodigital Dysplasia (ODDD): Linked to ECL1/ECL2 mutations disrupting channel docking .

Research Applications

Recombinant Chlorocebus aethiops GJA1 is utilized in:

Experimental Applications

ApplicationPurposeExample Findings
Structural BiologyCryo-EM mapping of channel conformationsResolved Cx43 gap junction structure at 2.26 Å
Cellular TraffickingStudy Rab11/Rab8-dependent ciliary vesicle transportGJA1 depletion disrupts Rab11 localization and ciliogenesis
Disease ModelingInvestigate ODDD-associated mutationsECL2 residue H194 substitutions impair channel docking
Antibody ValidationVerify specificity of anti-Cx43 reagents (e.g., Rockland 600-401-MJ2)Confirmed cross-reactivity with Chlorocebus aethiops GJA1

Table: Notable Studies Involving Recombinant GJA1

Study FocusSystem UsedMajor OutcomeSource
Microtubule BindingIn vitro pull-downC-terminal tail binds tubulin; critical for cytoskeletal anchoring
Ciliary DefectsXenopus MCCs, RPE1 cellsGJA1 depletion reduces Rab11/CP110 levels, impairing cilia formation
Ischemic ProtectionMouse heart modelGJA1-20k enhances mitochondrial biogenesis, mimicking ischemic preconditioning
Channel StructureCryo-EM of human Cx43Resolved pH-sensitive gating mechanism and ODDD mutation sites

Challenges and Future Directions

While recombinant GJA1 enables mechanistic studies, challenges persist:

  • Post-Translational Modifications: Phosphorylation sites (e.g., Ser368) critical for channel regulation may require mammalian expression systems for fidelity .

  • Isoform Complexity: Truncated isoforms (e.g., GJA1-20k) have distinct roles but are understudied in non-human primates .

Future work should prioritize high-resolution structural studies of Chlorocebus aethiops GJA1 in native membranes and its interaction with cardiac/neural disease targets.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GJA1; Gap junction alpha-1 protein; Connexin-43; Cx43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-382
Protein Length
Full Length of Mature Protein
Species
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Target Names
Target Protein Sequence
GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGV NVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSIFEVAFLLIQWYIYGFSL SAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVK GKSDPYHTTSGALSPTKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNY NKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQ RPSSRASSRASSRPRPDDLEI
Uniprot No.

Target Background

Function

Gap junction alpha-1 protein (GJA1) is a gap junction protein that regulates bladder capacity. Gap junctions are clusters of closely packed transmembrane channels (connexons) that facilitate the diffusion of low-molecular-weight materials between adjacent cells. GJA1 may play a crucial role in auditory physiology by participating in potassium recycling within the cochlear endolymph. It acts as a negative regulator of bladder functional capacity by enhancing intercellular electrical and chemical transmission, thereby sensitizing bladder muscles to cholinergic stimuli and promoting contraction. GJA1 may also participate in cell growth inhibition through the regulation of NOV expression and localization, and plays an essential role in gap junction communication within the ventricles.

Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Endoplasmic reticulum.

Q&A

What is GJA1 and where is it expressed?

GJA1 (Gap Junction Alpha-1 protein), also known as Connexin43, represents the most commonly expressed gap junction subunit in vertebrates . Gap junctions function as transport channels across cell membranes, facilitating intercellular communication. While traditionally recognized for its role in forming gap junction channels, GJA1 demonstrates localization to multiple cellular compartments beyond the plasma membrane, including motile ciliary axonemes and pericentriolar regions beneath primary cilia . This widespread distribution suggests functional versatility beyond classical gap junction communication.

How do different GJA1 isoforms arise?

While the GJA1 gene has a single coding exon and is not subject to splicing, its mRNA undergoes endogenous internal translation that generates several N-terminal truncated isoforms . The most prominent of these is GJA1-20k, which contains the full Connexin43 C-terminus but lacks transmembrane domains . This isoform is not membrane-bound and exhibits distinct localization patterns compared to full-length GJA1. The internal translation mechanism represents an important regulatory aspect of GJA1 biology, allowing the same gene to produce proteins with diverse functions depending on cellular conditions.

How does GJA1 contribute to cilia formation?

GJA1 plays a crucial role in both primary and motile ciliogenesis. Studies in human retinal pigment epithelium-1 (RPE1) cells and Xenopus laevis embryonic multiciliated cells demonstrate that GJA1 localizes to motile ciliary axonemes and pericentriolar regions beneath primary cilia . GJA1 depletion through siRNA or morpholino techniques results in significant malformation of both primary and motile cilia . Mechanistically, GJA1 appears to regulate early steps in ciliogenesis, including protein trafficking to the basal body and centriolar cap removal, which are essential prerequisites for cilia elongation.

What molecular interactions mediate GJA1's function in ciliogenesis?

Immunoprecipitation-mass spectrometry analysis identified Rab11 and Rab8a as putative GJA1-binding partners . Rab11, a key regulator during ciliogenesis, accumulates around the basal body region and is crucial for ciliary trafficking. GJA1 depletion causes mislocalization of Rab11, disrupting proper ciliary protein transport . Additionally, GJA1 knockdown affects the localization of other essential ciliary proteins such as BBS4 and CP110. Importantly, CP110 removal from the mother centriole—a critical step in cilia initiation—is significantly reduced following GJA1 depletion, suggesting GJA1 regulates centriole uncapping during early ciliogenesis .

What phenotypes result from GJA1 dysfunction in ciliated systems?

Experimental disruption of GJA1 function through dominant-negative constructs or morpholino-mediated knockdown in Xenopus embryos causes severe ciliary defects in multiciliated epithelial cells . These include malformed ciliary axonemes and abnormal basal body organization. In the Xenopus gastrocoel roof plate (GRP), GJA1 depletion impairs the formation of motile nodal cilia, leading to abnormal expression of left-right patterning markers such as PITX2 . In human RPE1 cells, siRNA-mediated GJA1 knockdown significantly disrupts primary cilia formation under serum starvation conditions, an effect that can be partially rescued by expressing siRNA-non-targetable GJA1 cDNA .

How does GJA1-20k affect mitochondrial morphology and function?

The internally translated GJA1 isoform, GJA1-20k, localizes to the outer mitochondrial membrane and dramatically influences mitochondrial morphology . Expression of GJA1-20k in cells results in smaller, more rounded mitochondria with a 54% decrease in average mitochondrial area . Conversely, siRNA-mediated knockdown of GJA1 increases mitochondrial size by approximately 20% . Functionally, GJA1-20k-induced smaller mitochondria exhibit decreased reactive oxygen species (ROS) generation and provide significant protection against ischemia-reperfusion injury in cardiac tissue . This suggests GJA1-20k mediates a beneficial adaptive response to cellular stress.

What is the mechanism of GJA1-20k-mediated mitochondrial fission?

GJA1-20k induces mitochondrial fission through a non-canonical mechanism that is independent of Dynamin-Related Protein 1 (DRP1), the canonical mediator of mitochondrial division . Instead, GJA1-20k polymerizes actin around mitochondria, creating focal constriction sites where fission events occur approximately 45 seconds after GJA1-20k recruitment . Mechanistically, GJA1-20k does not directly promote actin polymerization but rather inhibits actin depolymerization, shifting the polymerization-depolymerization equilibrium toward increased filament stability . This activity persists even in the presence of Latrunculin A, a potent inhibitor of actin polymerization.

How is GJA1-20k expression regulated during cellular stress?

GJA1-20k abundance increases dramatically in response to hypoxic and ischemic stress conditions . This stress-responsive upregulation appears to be a protective mechanism, as GJA1-20k overexpression mimics ischemic preconditioning in cardiac tissue . The rapid induction of GJA1-20k during stress onset suggests it functions as an acute protective response. Under normal conditions, GJA1-20k levels remain relatively low, limiting excessive mitochondrial fission in stable cells, particularly terminally differentiated cells like adult cardiomyocytes . This regulatory pattern positions GJA1-20k as a stress-responsive protein that confers protection during acute ischemic injury.

What experimental approaches are effective for GJA1 depletion studies?

Researchers have successfully employed several approaches to deplete GJA1 in different model systems. In mammalian cell lines such as human RPE1 cells, siRNA transfection effectively reduces GJA1 expression, as confirmed by immunoblotting . For in vivo studies in Xenopus embryos, antisense morpholino oligonucleotides (GJA1-MO) have been used to knockdown GJA1 expression . Dominant-negative GJA1 constructs represent another strategy, particularly useful for examining the effects of GJA1 dysfunction without completely eliminating the protein. Each approach should be validated through appropriate controls, including rescue experiments with siRNA-resistant constructs to confirm specificity .

What imaging techniques best visualize GJA1 localization and function?

Immunofluorescence analysis using specific antibodies against GJA1 effectively visualizes its subcellular localization . For studying GJA1's role in ciliogenesis, co-staining with ciliary markers like acetylated tubulin (axoneme) and centrin-GFP (basal bodies) provides valuable spatial information . Live-cell imaging with fluorescently tagged GJA1 constructs enables real-time analysis of protein dynamics. For instance, time-lapse imaging revealed that mitochondrial fission events occur within approximately 45 seconds of GJA1-20k recruitment of actin . Super-resolution microscopy techniques like structured illumination microscopy (SIM) can provide enhanced visualization of GJA1's association with subcellular structures.

What biochemical methods help identify GJA1 interaction partners?

Immunoprecipitation followed by mass spectrometry (IP-MS) analysis has successfully identified putative GJA1-binding partners, including Rab11 and Rab8a . Co-immunoprecipitation experiments provide verification of specific protein-protein interactions. For studying GJA1-20k's effect on actin dynamics, cell-free actin polymerization assays have proven valuable, demonstrating that GJA1-20k inhibits actin depolymerization rather than directly promoting polymerization . Proximity labeling techniques like BioID or APEX2 could complement these approaches by identifying proteins in close proximity to GJA1 in living cells, potentially revealing additional interaction partners in specific subcellular compartments.

How does GJA1 dysfunction relate to ciliopathies?

Given GJA1's essential role in ciliogenesis, its dysfunction potentially contributes to ciliopathies—genetic disorders characterized by defective ciliary structure or function . Mutations in genes essential for cilia formation disrupt ciliary structures or their functions, leading to syndromic disorders affecting multiple organ systems . While direct evidence linking GJA1 mutations to human ciliopathies requires further investigation, the severe ciliary defects observed following GJA1 depletion in model systems suggest it could be a candidate gene for unexplained ciliopathy cases. Further research examining GJA1 sequence variants in ciliopathy patients could provide valuable insights.

What therapeutic potential does GJA1-20k offer for ischemic conditions?

GJA1-20k presents promising therapeutic potential for conditions involving ischemia-reperfusion injury, such as myocardial infarction and stroke . The protective effects of GJA1-20k against ischemia-reperfusion damage in cardiac tissue suggest it could be developed as a pharmaceutical candidate for protecting organs undergoing anticipated ischemia, such as during cardiac surgery or organ transplantation . The ability of GJA1-20k to induce beneficial mitochondrial fission, resulting in decreased ROS generation without triggering apoptosis, distinguishes it from pathological fission processes. This makes GJA1-20k an attractive target for therapeutic interventions aimed at mitigating ischemic damage.

How might GJA1 research inform developmental disorder studies?

The involvement of GJA1 in left-right patterning through its role in motile nodal cilia formation has significant implications for developmental disorders . In Xenopus embryos, GJA1 depletion disrupts the formation of motile nodal cilia in the gastrocoel roof plate (GRP), leading to abnormal expression of left-right patterning markers like PITX2 . This suggests GJA1 dysfunction could contribute to heterotaxy and related conditions characterized by abnormal organ laterality. Additionally, GJA1's broader role in ciliogenesis might impact development of various organs that depend on ciliary signaling, including the brain, kidneys, and sensory organs, potentially linking GJA1 to a wider spectrum of developmental disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.