Recombinant Chlorocebus aethiops Gonadotropin-releasing hormone II receptor (GNRHR2)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

GNRHR2 is a seven-transmembrane domain receptor encoded by the GNRHR2 gene. It specifically binds GnRH II (pGlu-His-Trp-Ser-His-Gly-Trp-Tyr-Pro-Gly-NH₂), a conserved decapeptide involved in reproductive and non-reproductive functions . Unlike the type I GnRH receptor (GNRHR1), GNRHR2 retains a carboxyl-terminal tail and exhibits distinct ligand selectivity and signaling properties .

Key Features:

PropertyGNRHR2GNRHR1
Ligand SpecificityGnRH II (high affinity)GnRH I (high affinity)
C-terminal TailPresent (regulates internalization)Absent in primates
Tissue DistributionBrain, gonads, pituitary, gutPrimarily pituitary gonadotropes
EvolutionConserved in primates, absent in rodentsWidely present in vertebrates

Genomic Organization:

  • Gene Location: Flanked by PTPRA (5’) and MRPS26 (3’) genes, a conserved arrangement across mammals .

  • Exon-Intron Structure: Three exons and two introns, consistent with human and marmoset type II GnRH receptors .

  • Promoter Region: Lacks TATA/CAAT boxes but contains binding sites for SP1, AP-1, and CREB .

Protein Domains:

  • C-Terminal Tail: Critical for receptor trafficking and MAP kinase signaling .

  • Second Intracellular Loop: Contains a unique Ser140 residue (vs. Tyr in GNRHR1), influencing agonist affinity and internalization .

Recombinant Expression Systems

Recombinant GNRHR2 is typically produced in mammalian or yeast platforms for functional studies:

Common Platforms:

SystemAdvantagesExample Application
HEK293Post-translational modificationsLigand-binding assays
Pichia pastorisHigh yield, glycosylationStructural studies
E. coliCost-effective, rapid productionAntibody generation

A commercial example includes Recombinant Rhesus Macaque GNRHR2 (HEK293-derived), used for immunoassays and cell sorting .

Signaling Mechanisms

GNRHR2 activates multiple pathways:

  • Gαq/11: Mobilizes intracellular calcium and PKC .

  • MAP Kinases: Stimulates ERK1/2 and p38, influencing cell proliferation and differentiation .

  • Cross-Talk: In gonadotropes, coordinates with GNRHR1 to regulate luteinizing hormone secretion .

Reproductive Functions:

  • Gonadotrope Regulation: Co-expressed with GNRHR1 in primate pituitary cells, modulating gonadotropin release .

  • Steroidogenesis: Directly stimulates testosterone production in Leydig cells .

Non-Reproductive Functions:

  • Neuromodulation: Regulates sexual arousal and feeding behavior via hypothalamic circuits .

  • Cancer: Exhibits antiproliferative effects in ovarian and endometrial cancer cells .

Research Applications

  • Immunocontraception: Recombinant GnRH-GNRHR2 fusion proteins induce antibody-mediated gonad atrophy in animal models .

  • Drug Development: Targeted for therapies in hormone-dependent cancers .

  • Comparative Studies: Used to explore evolutionary divergence of GnRH systems in primates .

Challenges and Future Directions

  • Species-Specificity: Functional GNRHR2 is absent in rodents, limiting translational models .

  • Structural Insights: Cryo-EM studies are needed to resolve ligand-binding dynamics.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
GNRHR2; Gonadotropin-releasing hormone II receptor; GnRH II receptor; GnRH-II-R; Type II GnRH receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-379
Protein Length
full length protein
Species
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Target Names
GNRHR2
Target Protein Sequence
MSAGNGTPWGSAVGEEAWAGSGVAVEGSELPTFSTAAKVRVGVTIVLFVSSAGGNLAVLW SVTRPQPSQLRPSPVRTLFAHLAAADLLVTFVVMPLDATWNITVQWLAGDIACRTLMFLK LMAMYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLALPQLFLFHTVHRA GPVPFTQCVTKGSFKARWQETTYNLFTFCCLFLLPLIAMAICYSRIVLSVSSPQTRKGSH APAGEFALRRSFDNRPRVCLRALRLALLILLTFILCWTPYYLLGLWYWFSPTMLTEVPPS LSHILFLFGLLNAPLDPLLYGAFTFGCRRGHQELSIDSSKEGSGRMLQQEIHALRQQEVQ KTVTSRSAGETKGISITSI
Uniprot No.

Target Background

Function
Recombinant Chlorocebus aethiops Gonadotropin-releasing hormone II receptor (GNRHR2) is a receptor for gonadotropin releasing hormone II (GnRH II). This receptor mediates its action by associating with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Chlorocebus aethiops GNRHR2 and how does it differ from GNRHR1?

The Chlorocebus aethiops (African green monkey) GNRHR2 belongs to the rhodopsin superfamily of G-protein coupled receptors (GPCRs), featuring an extracellular N-terminus, seven transmembrane α-helical domains connected by three extracellular loops (ECLs) and three intracellular loops (ICLs) . The most distinctive structural difference between GNRHR2 and GNRHR1 is that GNRHR2 maintains a 52 amino acid C-terminal tail that is absent in GNRHR1 . This cytoplasmic tail is similar to those found in non-mammalian GnRHRs and is functionally significant as it promotes rapid receptor internalization and desensitization . The full-length porcine GNRHR2 (which shares structural characteristics with the African green monkey receptor) is 377 amino acids and shows approximately 42% homology to GNRHR1, which is 328 amino acids in length .

How does the African green monkey GNRHR2 mRNA translation occur despite potential disruptions in the coding sequence?

The African green monkey GNRHR2 employs alternative translation mechanisms to produce a functional receptor protein. Research indicates that the translation of African green monkey GNRHR2 mRNA may utilize an alternative start codon (GUG instead of the conventional AUG) . This alternative start codon is positioned downstream of frameshift locations that typically disrupt the reading frame in other species, enabling the production of a functional receptor with a truncated N-terminus (approximately 22 amino acids shorter) . This alternative translation mechanism allows the African green monkey to produce a functional GNRHR2 despite potential disruptive elements in the genomic sequence, demonstrating the evolutionary adaptability of this receptor system .

What are the binding characteristics of GNRHR2 and how selective is it for its ligands?

GNRHR2 demonstrates high selectivity for GnRH2 compared to other GnRH variants. Binding affinity studies show that GnRH2 binds to GNRHR2 with 24-fold greater affinity than to GNRHR1 . In functional assays using COS-1 cells expressing recombinant porcine GNRHR2, GnRH2 stimulated inositol phosphate production with an EC₅₀ of 0.5 nM compared to 220 nM for GnRH1 - indicating GnRH2 is approximately 440-fold more potent at GNRHR2 . Conversely, at GnRHR1, GnRH1 is only about 10-fold more active than GnRH2 . This marked selectivity pattern distinguishes the GNRHR2 signaling system from GNRHR1 and has significant implications for experimental design when studying GNRHR2 functions and for developing receptor-specific pharmacological tools .

What expression systems are most effective for producing functional recombinant Chlorocebus aethiops GNRHR2?

For functional expression of recombinant Chlorocebus aethiops GNRHR2, mammalian cell lines such as COS-1, COS-7, and cell lines derived from African green monkey kidney (e.g., Vero cells) have proven most effective. When establishing an expression system, researchers should consider:

  • Vector selection: Vectors containing strong promoters (CMV, SV40) optimize expression levels

  • Codon optimization: Adjusting codons to match host cell preferences improves translation efficiency

  • Signal sequence addition: Including an N-terminal signal sequence enhances membrane trafficking

For functional studies, COS-1 cells have been successfully used to characterize GnRH2 binding and signaling through recombinant GNRHR2, yielding reproducible results for inositol phosphate accumulation assays with an EC₅₀ of 0.5 nM for GnRH2 . For stable expression, lentiviral vector systems have proven effective in generating consistent receptor expression, as demonstrated in studies with porcine GNRHR2 .

What are the recommended methodologies for studying GNRHR2 signaling pathways in vitro?

To effectively study GNRHR2 signaling pathways in vitro, researchers should employ a multi-faceted approach:

  • Inositol Phosphate (IP) Accumulation Assay: This remains the gold standard for measuring GNRHR2 activation, as demonstrated in studies where COS-1 cells expressing porcine GNRHR2 showed IP production with an EC₅₀ of 0.5 nM for GnRH2 . The assay typically involves pre-labeling cells with ³H-myo-inositol and measuring phosphoinositide hydrolysis following receptor stimulation.

  • Intracellular Calcium Mobilization: Using fluorescent calcium indicators (Fura-2/AM or Fluo-4) to measure rapid calcium flux following receptor activation provides temporal resolution of signaling events.

  • Receptor Internalization Assays: GNRHR2 exhibits distinct internalization patterns from GNRHR1 due to its C-terminal tail. Both β-arrestin-dependent and independent pathways mediate GNRHR2 internalization, which can be studied using fluorescently tagged receptors or antibody-feeding techniques .

  • Agonist/Antagonist Discrimination: Using receptor-specific compounds is critical - GnRH2 is approximately 13-83 fold more potent at GNRHR2 than GnRHR1 superagonists like Triptorelin and Buserilin . For antagonist studies, Trptorelix-1 has been identified as GNRHR2-specific, while Cetrorelix and Antide preferentially target GNRHR1 .

  • Phosphorylation Studies: Analysis of serine residues 338 and 339 phosphorylation in the C-terminus is essential for understanding β-arrestin-independent internalization mechanisms .

What RNA interference approaches are most effective for GNRHR2 knockdown studies?

For effective GNRHR2 knockdown studies, lentiviral-delivered small hairpin RNA (shRNA) has demonstrated superior efficacy compared to traditional siRNA approaches. When designing RNAi experiments targeting GNRHR2:

  • Target sequence selection: Multiple shRNA sequences targeting different regions of GNRHR2 mRNA should be designed and screened. For example, in porcine models, researchers identified effective target sequences that produced significant knockdown of GNRHR2 expression .

  • Delivery method optimization: Lentiviral vectors have proven particularly effective for stable, long-term knockdown. In transgenic animal studies, lentiviral particles containing shRNA constructs were microinjected into the perivitelline space of zygotes, resulting in successful transgenic offspring with reduced GNRHR2 expression .

  • Validation approaches: Digital droplet PCR (ddPCR) provides superior quantification of knockdown efficiency compared to traditional qPCR methods. This technique was successfully employed to validate GNRHR2 knockdown in transgenic swine models .

  • Control considerations: Proper controls include non-targeting shRNA sequences and validation across multiple cell types to ensure specificity of knockdown effects.

  • Phenotypic measurement: When evaluating knockdown effects, multiple parameters should be assessed, as demonstrated in porcine models where both testis size and testosterone levels were measured following GNRHR2 knockdown, revealing significant physiological impacts despite unchanged body weight .

How does the functionality of Chlorocebus aethiops GNRHR2 compare to other primate GNRHR2 homologs?

The Chlorocebus aethiops (African green monkey) GNRHR2 represents one of the few functionally active type II GnRH receptors among primates. Comparative analysis reveals significant interspecies variation:

  • Functional status: While African green monkey and marmoset GNRHR2 maintain full functionality, the human GNRHR2 gene homolog contains a frameshift and premature stop codon that disrupts conventional receptor expression . This creates a distinct evolutionary pattern where some primates maintain functional GNRHR2 while others, including humans, have disrupted genes.

  • Translation mechanisms: The African green monkey GNRHR2 employs alternative translation using a GUG codon instead of the conventional AUG start codon, allowing production of a functional receptor despite potential genomic disruptions . This alternative start codon is positioned downstream of the frameshift and would yield a receptor with a truncated N-terminus (22 amino acids shorter) .

  • Binding properties: Functional studies demonstrate that both African green monkey and marmoset GNRHR2 show high selectivity for GnRH2 compared to GnRH1, with similar binding affinity profiles .

  • Signal transduction: The African green monkey GNRHR2 exhibits robust signaling capacity through phospholipase C activation and inositol phosphate production, comparable to other functional primate GNRHR2s .

This evolutionary divergence in receptor functionality among primates suggests potential species-specific adaptations in reproductive neuroendocrine regulation and provides a valuable comparative model for understanding the physiological significance of GNRHR2 signaling.

What mechanisms might explain the maintenance of a functional GNRHR2 in Chlorocebus aethiops versus the disrupted gene in humans?

The preservation of functional GNRHR2 in Chlorocebus aethiops compared to the disrupted gene in humans likely reflects distinct evolutionary pressures and adaptive mechanisms. Several potential explanations include:

  • Differential selective pressures: African green monkeys may have maintained selective pressures favoring GNRHR2 functionality related to reproductive physiology or behavior that became redundant or unnecessary in human evolution.

  • Alternative compensatory pathways: Humans may have developed compensatory signaling mechanisms through GNRHR1 or other receptors that rendered GNRHR2 functionally redundant, allowing accumulation of disruptive mutations.

  • Translational rescue mechanisms: The African green monkey has developed alternative translational mechanisms utilizing a GUG start codon downstream of disruptive elements, producing a functional receptor with a slightly truncated N-terminus . This adaptive mechanism may have preserved receptor functionality despite genomic challenges.

  • Corrective reading frame shifts: Research suggests potential counteractive shifts in the reading frame could restore functionality in seemingly non-translatable mRNA sequences . Such mechanisms may operate in African green monkeys but not humans.

  • Alternative splicing: Different splicing patterns between species might explain the maintenance of functional transcripts in African green monkeys compared to humans, as some human GNRHR2 transcripts missing the stop codon have been isolated .

Understanding these mechanisms provides insights into the evolutionary dynamics of reproductive neuroendocrinology across primate species and may reveal novel translation regulation pathways with broader biological significance.

How does the C-terminal tail of GNRHR2 influence its internalization and signaling properties?

The 52 amino acid C-terminal tail of GNRHR2 fundamentally distinguishes its cellular trafficking and signaling dynamics from GNRHR1, which lacks this structural feature . This cytoplasmic tail has profound functional implications:

  • Receptor desensitization kinetics: The C-terminal tail enables rapid desensitization of GNRHR2. Studies demonstrated that monkey GNRHR2 fully desensitized to GnRH2 treatment after 60 minutes, whereas the tail-less human GNRHR1 failed to desensitize to agonist treatment (Triptorelin) even after 90 minutes of continuous exposure .

  • Internalization pathways: GNRHR2 utilizes dual internalization mechanisms:

    • β-arrestin-dependent pathway: The C-terminal tail can interact with β-arrestin to facilitate internalization, though this interaction is not absolutely required .

    • β-arrestin-independent pathway: Phosphorylation of serine residues 338 and 339 in the C-terminus by GPCR kinases is critical for this alternative internalization mechanism .

  • Endocytic machinery interaction: GNRHR2 internalization depends on dynamin and involves both clathrin-coated pits and caveolae-mediated pathways, providing multiple trafficking routes not available to GNRHR1 .

  • Signal termination control: The presence of the C-terminal tail creates additional regulatory control points for signal modulation and termination, allowing for more precisely regulated signaling duration compared to GNRHR1.

These structural and functional differences offer researchers important targets for developing receptor-selective compounds and explain the distinct physiological roles of these related receptors in reproductive neuroendocrinology.

What is known about the signaling cascade differences between GNRHR1 and GNRHR2 in mammalian cells?

GNRHR1 and GNRHR2 exhibit distinct signaling profiles despite activating overlapping downstream pathways:

  • G-protein coupling preferences: While both receptors couple to Gq/11 proteins to activate phospholipase C, GNRHR2 demonstrates greater coupling efficiency to this pathway when stimulated by its cognate ligand GnRH2. In functional assays, GnRH2 stimulates inositol phosphate production through GNRHR2 with an EC₅₀ of 0.5 nM compared to 220 nM for GnRH1 activation of the same pathway .

  • Receptor selectivity patterns: GNRHR2 shows marked ligand selectivity (GnRH2 is 100-400 fold more active than GnRH1), while GNRHR1 exhibits less discrimination (GnRH1 is only approximately 10-fold more active than GnRH2) . This differential selectivity creates distinct signaling thresholds and response patterns.

  • Desensitization kinetics: GNRHR2 undergoes rapid desensitization due to its C-terminal tail, whereas GNRHR1 shows prolonged signaling without significant desensitization during continuous agonist exposure . This creates fundamentally different temporal signaling profiles between the receptors.

  • Internalization mechanisms: GNRHR2 utilizes both β-arrestin-dependent and independent pathways for internalization, while GNRHR1 internalizes without β-arrestin interaction . This difference affects signal termination and potential receptor resensitization kinetics.

  • Biased signaling potential: The structural differences between these receptors suggest they may exhibit distinct patterns of biased signaling when exposed to various ligands, though this aspect requires further investigation in the context of Chlorocebus aethiops GNRHR2.

Understanding these signaling differences provides critical insights for receptor-selective drug development and for interpreting physiological effects of GnRH peptides across species.

How does the GNRHR2-reliquum modulate GNRHR1 function and what are the molecular mechanisms involved?

The GNRHR2-reliquum (the disrupted gene product of GNRHR2) exerts significant inhibitory effects on GNRHR1 expression and function through specific molecular mechanisms:

  • Reduced cell surface expression: Cotransfection studies with GnRHR-I and GnRHR-II-reliquum constructs into COS-7 cells demonstrated that the GNRHR2-reliquum significantly reduced GNRHR1 expression at the cell surface . This effect was specific and directly proportional to the amount of GNRHR2-reliquum expressed .

  • Impaired signaling capacity: The presence of GNRHR2-reliquum substantially reduced GnRH-induced inositol phosphate accumulation through GNRHR1, indicating compromised signaling capacity . This effect provides a potential regulatory mechanism for modulating GNRHR1 activity.

  • Reduction of total receptor protein: Immunoblot analysis revealed that the total cellular GNRHR1 protein (both surface and intracellular receptors) was markedly reduced by GNRHR2-reliquum coexpression . This suggests interference with receptor biosynthesis or stability rather than simply affecting trafficking.

  • Subcellular site of action: The inhibitory effect appears to occur at the nucleus/endoplasmic reticulum or Golgi apparatus level, potentially disrupting normal processing and maturation of GNRHR1 . This was demonstrated through experiments with protein synthesis inhibitors (cycloheximide) and protease inhibitors (leupeptin and phenylmethylsulfonyl fluoride), which failed to alter the inhibitory effect .

  • Independence from degradation pathways: The inhibitory effect persisted despite blockade of proteinase-mediated degradation, suggesting the mechanism involves interference with receptor biosynthesis rather than enhanced degradation .

This modulatory relationship between GNRHR2-reliquum and GNRHR1 represents a novel regulatory mechanism that may have physiological significance in species like humans where the GNRHR2 gene is disrupted but still expressed.

What is the evidence for GNRHR2's role in gonadotropin secretion versus direct gonadal effects?

The physiological role of GNRHR2 in gonadotropin secretion versus direct gonadal effects shows distinct patterns across species and experimental systems:

  • Gonadotropin secretion effects: GnRH2 acting through GNRHR2 appears to be a relatively weak stimulator of gonadotropin secretion compared to GnRH1. Initial studies demonstrated that GnRH2 was 68% less effective than GnRH1 at eliciting LH release and 59% less effective at stimulating FSH release from rat pituitary cell cultures . Similar results were observed in sheep, where GnRH2 was 92% less effective than GnRH1 at stimulating gonadotropin secretion . These effects appear to be mediated primarily through GNRHR1 rather than GNRHR2, as species like rats and sheep lack functional GNRHR2 .

  • Direct gonadal actions: Evidence suggests GNRHR2 may have significant direct gonadal effects independent of pituitary gonadotropin secretion. In swine, which maintain functional GNRHR2, both GNRH2 and GNRHR2 proteins are abundantly produced within the testis, with GNRHR2 immunolocalized specifically to Leydig cells . Functional studies demonstrated that exogenous GNRH2 treatment stimulated LH-independent testosterone secretion from boar testes, suggesting a direct paracrine regulatory mechanism .

  • Reproductive consequences of GNRHR2 manipulation: Transgenic GNRHR2 knockdown boars exhibited smaller testes and reduced testosterone levels compared to littermate controls despite normal body weight, providing strong evidence for direct gonadal functions . This phenotype was observed despite no significant changes in LH levels, further supporting direct testicular effects independent of gonadotropin action .

This evidence suggests GNRHR2 may have evolved specialized roles in direct gonadal regulation in species maintaining functional receptors, while its role in pituitary gonadotropin regulation appears less significant or has been supplanted by GNRHR1.

What are the methodological approaches for investigating GNRHR2-mediated steroidogenesis in reproductive tissues?

Investigating GNRHR2-mediated steroidogenesis in reproductive tissues requires carefully designed methodological approaches:

  • Ex vivo tissue culture systems: Isolated testicular or ovarian tissue explants maintained in media allow direct assessment of GNRHR2-mediated steroidogenesis while preserving tissue architecture. This approach revealed that exogenous GNRH2 treatment stimulated LH-independent testosterone secretion from boar testes, suggesting direct paracrine regulatory mechanisms .

  • Primary cell isolation techniques: Isolating specific steroidogenic cells (e.g., Leydig cells from testes) enables precise characterization of GNRHR2 expression and function. Immunolocalization studies have demonstrated GNRHR2 expression specifically in porcine Leydig cells, supporting their role in direct testosterone production .

  • Transgenic models with tissue-specific manipulation: Generation of GNRHR2 knockdown models provides powerful tools for investigating receptor function. Lentiviral-delivered shRNA has been successfully employed to create GNRHR2 knockdown swine, revealing significant reproductive impacts . The methodology typically involves:

    • Designing shRNA targeting GNRHR2

    • Generating lentiviral particles containing the constructs

    • Microinjecting viral particles into zygotes

    • Transferring embryos to recipients

    • Validating knockdown efficiency in offspring

  • Steroidogenic pathway analysis: Comprehensive steroid profiling using liquid chromatography-mass spectrometry enables detection of changes across multiple steroid hormones and intermediates, providing insights into which steroidogenic enzymes are affected by GNRHR2 signaling.

  • Receptor-specific pharmacological tools: Using selective GNRHR2 agonists (GnRH2) and antagonists (Trptorelix-1) while avoiding cross-reactive compounds allows specific targeting of GNRHR2 pathways . For example, GnRH2 is 13-83 fold more potent at GNRHR2 than GnRHR1 superagonists like Triptorelin and Buserilin .

These methodological approaches provide complementary strategies for elucidating the complex role of GNRHR2 in reproductive tissue steroidogenesis.

What technical considerations are critical when developing transgenic models to study GNRHR2 function?

Developing effective transgenic models to study GNRHR2 function requires addressing several critical technical considerations:

  • Gene targeting strategy selection: For GNRHR2 studies, RNA interference has proven particularly effective. Successful transgenic models have been generated using lentiviral-delivered shRNA targeting GNRHR2 . This approach offers advantages over complete knockout models by allowing modulation of expression levels rather than complete elimination, which may better represent physiological regulation.

  • Vector design optimization: Lentiviral vectors containing appropriate promoters and shRNA sequences must be carefully designed. Validation of knockdown efficiency should be performed in relevant cell lines before animal studies. For example, testing GNRHR2 shRNA constructs in swine testis-derived (ST) cells demonstrated significant reduction in mRNA levels prior to animal studies .

  • Delivery method refinement: For reproductive studies, microinjection of lentiviral particles into the perivitelline space of zygotes has proven effective . This approach resulted in successful transgenic offspring with approximately 57% of progeny carrying the transgene in one study .

  • Validation methodology selection: Digital droplet PCR (ddPCR) provides superior quantification of knockdown efficiency compared to traditional qPCR methods . This technique offers absolute quantification of target transcripts and should be employed alongside appropriate housekeeping genes (e.g., ACTB) .

  • Phenotypic analysis design: Comprehensive phenotypic assessment should include:

    • Morphological parameters (body weight, reproductive organ size)

    • Hormonal profiling (testosterone, LH, FSH)

    • Age-dependent measurements at multiple timepoints

    • Tissue-specific expression analysis

When implementing these technical considerations, researchers should anticipate potential compensatory mechanisms that may arise in transgenic models and design experiments to detect these adaptations.

What strategies can address the challenges of distinguishing GNRHR2-specific signaling from GNRHR1 effects in experimental systems?

Distinguishing GNRHR2-specific signaling from GNRHR1 effects presents significant challenges that require sophisticated experimental approaches:

  • Receptor-selective pharmacological tools: Employing ligands with validated receptor selectivity is critical. GnRH2 binds GNRHR2 with 24-fold greater affinity than GNRHR1 , while Trptorelix-1 has been identified as a GNRHR2-specific antagonist . Conversely, Cetrorelix and Antide preferentially target GNRHR1, though at high concentrations Cetrorelix can non-specifically bind GNRHR2 . Researchers must carefully select concentrations that maintain receptor selectivity.

  • Receptor knockout/knockdown models: Generating cell lines or animal models with selective GNRHR1 or GNRHR2 knockdown enables clear delineation of receptor-specific effects. Lentiviral-delivered shRNA approaches have successfully produced GNRHR2 knockdown models in swine , providing valuable systems for distinguishing receptor functions.

  • Heterologous expression systems: Expressing recombinant GNRHR2 in cell lines lacking endogenous GnRH receptors allows isolation of GNRHR2-specific signaling. COS-1 cells have been successfully used to characterize GnRH2 binding and signaling through recombinant GNRHR2 .

  • Receptor mutagenesis approaches: Creating receptor chimeras or point mutations in key domains can help identify structural determinants of receptor-specific signaling. The C-terminal tail of GNRHR2, particularly serine residues 338 and 339, represents a critical region for receptor-specific functions .

  • Signaling pathway inhibitors: Using inhibitors of specific downstream pathways while monitoring receptor activation can reveal distinct signaling profiles between receptors.

  • Temporal analysis of receptor responses: The distinct desensitization kinetics between GNRHR1 and GNRHR2 (with GNRHR2 desensitizing much more rapidly due to its C-terminal tail) provides a temporal window for distinguishing receptor-specific effects.

These approaches, used in combination, provide powerful tools for delineating the specific contributions of GNRHR2 signaling in complex biological systems.

How can researchers address the challenges of producing and purifying functional recombinant GNRHR2 for structural and binding studies?

Producing and purifying functional recombinant GNRHR2 for structural and binding studies presents significant technical challenges requiring specialized approaches:

  • Expression system selection: Mammalian expression systems provide the most native-like post-translational modifications for GNRHR2. Specifically:

    • HEK293S GnTI⁻ cells enable production of homogeneously glycosylated receptors suitable for structural studies

    • Inducible expression systems (T-REx) allow tight control of expression timing, minimizing potential toxicity

    • Baculovirus-insect cell systems offer scalability advantages while maintaining most mammalian-like processing

  • Construct optimization:

    • Adding N-terminal signal sequences (e.g., hemagglutinin signal sequence) improves membrane targeting

    • Incorporating affinity tags (FLAG, His₁₀) facilitates purification while minimizing functional interference

    • Including thermostabilizing mutations identified through alanine scanning can enhance receptor stability

    • Fusion with T4 lysozyme or BRIL in intracellular loop 3 can facilitate crystallization for structural studies

  • Solubilization optimization:

    • Mild detergents like n-dodecyl-β-D-maltopyranoside (DDM) supplemented with cholesteryl hemisuccinate (CHS) effectively solubilize GNRHR2 while preserving functionality

    • Lipid nanodiscs provide a more native-like membrane environment for functional studies

    • Styrene maleic acid lipid particles (SMALPs) allow extraction with surrounding lipid environment intact

  • Stabilization strategies:

    • Adding high-affinity ligands during purification enhances conformational stability

    • Cholesterol and specific phospholipids (particularly phosphatidylinositol 4,5-bisphosphate) maintain receptor functionality

    • Glycerol and specific ionic conditions prevent aggregation during concentration steps

  • Functional validation methods:

    • Isothermal titration calorimetry provides direct measurement of binding thermodynamics

    • Surface plasmon resonance enables real-time binding kinetics analysis

    • Fluorescence-based ligand binding assays offer high-throughput screening capabilities

These methodological approaches address the specific challenges of GNRHR2 as a seven-transmembrane receptor with complex conformational dynamics and post-translational modifications.

What are the most promising approaches for investigating potential non-reproductive functions of GNRHR2 in Chlorocebus aethiops and other primates?

Investigating non-reproductive functions of GNRHR2 in Chlorocebus aethiops and other primates requires innovative approaches that extend beyond traditional reproductive endocrinology:

  • Tissue-specific expression profiling: Comprehensive transcriptomic analysis across multiple tissues using RNA-seq and digital droplet PCR can identify unexpected sites of GNRHR2 expression . Particular attention should be paid to non-reproductive tissues such as the central nervous system, immune cells, and gastrointestinal tract where GnRH peptides have demonstrated alternative functions.

  • Single-cell RNA sequencing: This approach can reveal specific cell populations expressing GNRHR2 within heterogeneous tissues, providing insights into potential specialized functions outside reproductive organs.

  • Conditional tissue-specific knockdown models: Developing primate cell and tissue models with inducible GNRHR2 knockdown in specific tissues allows systematic evaluation of receptor function across multiple physiological systems.

  • Functional metabolomics and proteomics: Comprehensive metabolomic and proteomic profiling following GNRHR2 activation or inhibition in various tissues can reveal unexpected signaling pathways and metabolic effects beyond classical reproductive functions.

  • Behavioral phenotyping: Given the potential role of GnRH2 in feeding behavior regulation and energy homeostasis, systematic behavioral assessment following GNRHR2 manipulation may reveal important non-reproductive functions.

  • Comparative evolutionary approaches: Cross-species analysis of GNRHR2 conservation patterns in specific tissues can provide insights into evolutionarily preserved non-reproductive functions. Special attention should be paid to species with functional versus disrupted GNRHR2 genes to identify potential compensatory mechanisms.

  • Ex vivo tissue explant studies: Utilizing tissue explants from multiple organ systems to assess direct effects of GnRH2 stimulation on tissue-specific functions can reveal novel roles independent of reproductive regulation.

These approaches provide a comprehensive framework for exploring the potentially diverse functions of GNRHR2 beyond its established roles in reproductive physiology, potentially revealing new therapeutic targets or biological mechanisms.

What novel genome editing approaches show the most promise for studying GNRHR2 function in primate models?

The study of GNRHR2 function in primate models is entering a new era with advanced genome editing technologies that offer unprecedented precision and efficiency:

  • Prime editing systems: This "search-and-replace" genome editing approach offers advantages over traditional CRISPR-Cas9 by enabling precise nucleotide changes without double-strand breaks. For GNRHR2 studies, prime editing could:

    • Restore functionality to disrupted GNRHR2 genes in species like humans

    • Introduce specific mutations to study structure-function relationships

    • Create reporter knock-ins without disrupting endogenous regulation

  • Base editing technologies: These systems enable direct conversion of specific nucleotides without DNA cleavage, offering efficient tools to:

    • Correct disruptive mutations in GNRHR2 genes

    • Introduce premature stop codons for functional studies

    • Modify regulatory elements controlling GNRHR2 expression

  • CRISPR-Cas9 with enhanced HDR: Combining CRISPR-Cas9 with improved homology-directed repair (HDR) enhancers and modified donor templates significantly increases precise editing efficiency in primate cells, enabling:

    • Introduction of epitope tags for tracking endogenous GNRHR2

    • Generation of conditional knockout models through introduction of loxP sites

    • Creation of fluorescent reporter knock-ins for real-time visualization of receptor expression

  • Tissue-specific inducible systems: Combining genome editing with tissue-specific promoters and inducible systems allows:

    • Temporal control of GNRHR2 expression or knockout

    • Tissue-restricted manipulation to avoid developmental effects

    • Cell-type specific studies to delineate GNRHR2 function in complex tissues

  • Non-human primate embryonic stem cell models: Generating genome-edited embryonic stem cell lines from primates like Chlorocebus aethiops provides valuable in vitro models for studying GNRHR2 function before proceeding to more resource-intensive animal studies.

These advanced genome editing approaches offer significant advantages over traditional transgenic methods by enabling precise manipulation of the endogenous GNRHR2 locus while maintaining native regulatory elements and expression patterns.

How might single-cell multi-omics approaches advance our understanding of GNRHR2 signaling networks in reproductive tissues?

Single-cell multi-omics approaches offer unprecedented insights into GNRHR2 signaling networks in reproductive tissues by revealing cellular heterogeneity and molecular interactions at single-cell resolution:

  • Single-cell RNA sequencing (scRNA-seq): This technology enables characterization of GNRHR2 expression patterns across diverse cell populations within reproductive tissues, revealing:

    • Previously unrecognized cell types expressing GNRHR2

    • Cell state-dependent regulation of receptor expression

    • Coexpression patterns with potential signaling partners

    • Transcriptional consequences of receptor activation at single-cell resolution

  • Single-cell ATAC-seq (scATAC-seq): By profiling chromatin accessibility, this approach illuminates the regulatory landscape controlling GNRHR2 expression:

    • Cell type-specific enhancer elements governing receptor expression

    • Dynamic chromatin reorganization following receptor activation

    • Transcription factor binding patterns that regulate receptor levels

  • Single-cell proteomics and phosphoproteomics: These emerging technologies enable profiling of:

    • Cell-specific GNRHR2 protein levels and post-translational modifications

    • Phosphorylation cascades triggered by receptor activation

    • Protein interaction networks in different cell populations

  • Spatial transcriptomics: By preserving spatial information, these approaches reveal:

    • Anatomical distribution of GNRHR2-expressing cells within complex tissues

    • Potential paracrine signaling networks between receptor-expressing and target cells

    • Microenvironmental influences on receptor expression and function

  • Integrated multi-omics analysis: Combining multiple single-cell modalities through computational integration provides:

    • Comprehensive signaling network reconstruction

    • Identification of cell state transitions following receptor activation

    • Causal relationships between chromatin states, transcription, and signaling outcomes

These approaches could reveal previously unrecognized heterogeneity in GNRHR2 expression and signaling across different cell populations within reproductive tissues, potentially identifying specialized functions and novel therapeutic targets.

What computational modeling approaches can advance our understanding of the evolutionary dynamics of GNRHR2 function across primate species?

Advanced computational modeling approaches offer powerful tools for understanding the evolutionary dynamics of GNRHR2 across primate species:

  • Molecular dynamics simulations: These computational approaches can model the structural consequences of species-specific sequence variations in GNRHR2:

    • Simulating receptor-ligand interactions to predict binding affinity differences

    • Modeling conformational changes during receptor activation

    • Identifying critical residues that determine species-specific signaling properties

    • Predicting the functional impact of alternative translation mechanisms like those observed in African green monkey GNRHR2

  • Phylogenetic comparative methods: These statistical approaches enable:

    • Reconstruction of ancestral GNRHR2 sequences across the primate lineage

    • Identification of sites under positive or negative selection

    • Correlation of receptor changes with reproductive trait evolution

    • Detection of convergent evolution in receptor function

  • Systems biology modeling: Integrative computational approaches can:

    • Model species-specific GNRHR2 signaling networks

    • Predict compensatory mechanisms in species with disrupted receptors

    • Simulate the impact of GNRHR2-reliquum on GNRHR1 function across species

    • Generate testable hypotheses about receptor function

  • Coevolutionary network analysis: These approaches examine coordinated evolutionary changes between GNRHR2 and:

    • Its ligand GnRH2

    • Downstream signaling partners

    • Potential regulatory proteins

    • Other reproductive system components

  • Translational efficiency models: Computational prediction of translation efficiency based on:

    • Codon usage bias across species

    • RNA secondary structure differences

    • Alternative translation initiation sites like the GUG codon in African green monkey GNRHR2

    • Potential frameshifting mechanisms that might rescue seemingly disrupted genes

These computational approaches, integrated with experimental data, can provide crucial insights into the evolutionary forces shaping GNRHR2 function across primates and help explain the maintenance of functional receptors in some species despite disruption in others.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.