Recombinant Chlorocebus aethiops Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing your order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Target Names
Target Protein Sequence
MPVQGSQRRLLGSLNSTPTATPHLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVV TAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVLFSMLFI AYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQCPAHQGFGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function
This receptor binds to melanocyte-stimulating hormone (MSH) isoforms (alpha, beta, and gamma) and adrenocorticotropic hormone (ACTH). Its activity is mediated by G proteins, which stimulate adenylate cyclase. The receptor plays a critical role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Chlorocebus aethiops MC1R and how does it compare to human MC1R?

The Chlorocebus aethiops MC1R, like its human counterpart, is a seven-transmembrane G protein-coupled receptor. The human MC1R consists of 317 amino acids with seven α-helical transmembrane (TM) domains, an N-linked glycosylation site at the external N-terminus, and a palmitoylation site at the intracellular C-terminus . Vervet monkey MC1R shares high sequence homology with human MC1R, making it valuable for comparative research. The structure includes intracellular and transmembrane domains that regulate adenylyl cyclase connections and signaling, while the extracellular and transmembrane domains interact with MC1R ligands . Recent Cryo-electron microscopy has determined the structure of MC1R and the MC1R–Gs complexes bound to α-MSH, providing critical insights into the receptor's functional architecture .

How does Chlorocebus aethiops MC1R signaling differ from other melanocortin receptors?

The MC1R signaling pathway primarily involves activation of adenylyl cyclase upon ligand binding, which increases cyclic adenosine monophosphate (cAMP) production. This leads to the assembly of a multi-protein complex stabilized by the P gene protein . This complex is directly responsible for converting DOPAquinone to eumelanin, affecting the eumelanin-to-phaeomelanin ratio that determines skin and hair coloration . While the basic signaling mechanism is similar across species, the Chlorocebus MC1R may exhibit subtle differences in ligand binding affinity and downstream effector coupling, which can be important considerations for cross-species experimental designs. The MC1R/cAMP/PKA/Nurr1 signaling pathway has been shown to mediate anti-inflammatory and neuroprotective effects in neurological damage models .

What unique binding properties does recombinant Chlorocebus aethiops MC1R exhibit with various ligands?

Recombinant Chlorocebus MC1R exhibits specific binding properties with endogenous hormones like α-MSH and synthetic agonists. The extracellular N-terminal tail serves as a signal anchor and plays a crucial role in ligand affinity . A conserved cysteine residue at the intersection of the N-terminus and the first transmembrane domain is critical for receptor function . The extracellular loops (els) of the MC1R, though smaller than most GPCRs, are essential for constitutive basal signaling activity and interact with ligands . When designing binding studies with recombinant Chlorocebus MC1R, researchers should consider these structural features and potential species-specific binding affinities.

What are the optimal expression systems for producing functional recombinant Chlorocebus aethiops MC1R?

For successful expression of functional recombinant Chlorocebus MC1R, mammalian expression systems are generally preferred over bacterial systems due to the requirement for post-translational modifications and proper membrane insertion. HEK293 and CHO cell lines have proven effective for GPCR expression. When designing expression vectors, inclusion of affinity tags (such as His6 or FLAG) at either the N- or C-terminus can facilitate purification, but researchers should verify that these modifications do not interfere with receptor function. For structural studies requiring higher protein yields, insect cell expression systems using baculovirus may be beneficial. The expression system should be carefully selected based on the specific research application, considering factors such as glycosylation patterns and functional coupling to G proteins.

What purification strategies yield the highest functional activity for recombinant Chlorocebus MC1R?

Purification of functional MC1R requires careful consideration of detergent selection and stabilization conditions. For maximum functional activity, researchers should consider a two-step purification approach: 1) Initial solubilization from cellular membranes using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG), followed by 2) Affinity chromatography using tags engineered into the recombinant construct. The recent success with Cryo-EM structures of MC1R suggests that lipid nanodisc reconstitution following purification may help maintain native-like functionality . Temperature control during purification (typically 4°C) and inclusion of phosphatase inhibitors can preserve receptor phosphorylation states important for signaling studies.

How can researchers verify the functional integrity of purified recombinant Chlorocebus aethiops MC1R?

Functional validation of purified recombinant MC1R should employ multiple complementary approaches. Ligand binding assays using radiolabeled or fluorescently labeled α-MSH can confirm binding activity. G protein coupling can be assessed through GTPγS binding assays or BRET-based interaction studies. For activity assessment, reconstitution into artificial membrane systems followed by cAMP accumulation assays provides valuable functional data. Thermal stability assays (TSA) can evaluate protein stability under different buffer conditions. Circular dichroism spectroscopy helps confirm proper secondary structure. Additionally, verifying glycosylation status through glycosidase treatments and Western blotting can ensure proper post-translational modifications crucial for receptor function.

How can recombinant Chlorocebus aethiops MC1R be utilized in immunological research models?

Recombinant Chlorocebus MC1R offers valuable research applications in immunology, particularly given the expression of MC1R on CD8+ T cells and its role in cytotoxicity . Researchers can utilize the recombinant receptor to study α-MSH/MC1R signaling in T cell function. In experimental designs, the recombinant protein can be incorporated into in vitro assays to examine effects on cytokine production, cytotoxic gene expression, and T cell activation. Research has demonstrated that α-MSH/MC1R-mediated signaling is critical for cytotoxicity induction in both human and murine CD8+ T cells . Additionally, α-MSH-treated CD8+ T cells showed reduced contact allergy responses in recipient mice upon adoptive transfer, highlighting potential therapeutic applications . When studying these immunomodulatory effects, researchers should include appropriate controls with non-functional MC1R variants to confirm specificity.

What experimental approaches are recommended for studying MC1R variants using recombinant Chlorocebus systems?

When investigating MC1R variants, researchers should consider site-directed mutagenesis of recombinant Chlorocebus MC1R constructs to introduce specific variants observed in population studies. Functional analyses should include:

  • Receptor expression and trafficking studies using fluorescently tagged constructs

  • Ligand binding assays comparing wild-type and variant receptors

  • cAMP signaling assays to assess functional consequences of variants

  • Protein stability and half-life determinations

For comprehensive variant analysis, researchers could implement approaches similar to those used in human MC1R studies, where variants are classified according to their cross-species conservation (SIFT) and predicted structural alterations (PolyPhen) . When designing these experiments, it's important to consider that variants may affect different aspects of receptor function, from ligand binding to G protein coupling or receptor internalization.

How can recombinant Chlorocebus MC1R be applied in drug discovery for inflammatory and neurological conditions?

Recombinant Chlorocebus MC1R provides a valuable tool for screening potential therapeutic compounds targeting inflammatory and neurological conditions. Research has shown that MC1R activation has anti-inflammatory and neuroprotective effects in various neurological disorders . Experimental approaches should include:

  • High-throughput screening assays using the recombinant receptor to identify novel ligands

  • Structure-activity relationship studies with identified compounds

  • Functional assays measuring downstream signaling events (cAMP production, PKA activation)

  • Testing promising compounds in relevant cellular models (e.g., microglial cells for neuroinflammation studies)

The MC1R/cAMP/PKA/Nurr1 signaling pathway has been implicated in reducing neuroinflammation in hypoxic-ischemic neurological damage models, suggesting therapeutic potential for conditions like hypoxic-ischemic encephalopathy in newborns . Additionally, MC1R activation has shown promise in atherosclerosis models by affecting cholesterol transport and monocyte deposition .

How does recombinant Chlorocebus aethiops MC1R compare functionally to human MC1R in experimental settings?

Comparative functional studies between Chlorocebus and human MC1R can reveal important evolutionary conservations and divergences. When conducting such studies, researchers should employ identical experimental conditions and readouts for both receptors. Key parameters to compare include:

  • Ligand binding affinities for endogenous (α-MSH, ACTH) and synthetic ligands

  • cAMP signaling potency and efficacy

  • Receptor desensitization and internalization kinetics

  • Interaction profiles with different G protein subtypes

Human MC1R is known to be primarily expressed on melanocytes with approximately 700 protein units per cell, slightly higher on melanoma cells . Comparative expression studies should normalize for receptor density to ensure accurate functional comparisons. The evolutionary conservation of key functional domains between primate MC1Rs suggests similar pharmacological properties, but species-specific differences may exist particularly in the extracellular loops that affect ligand binding.

What insights can genomic and evolutionary studies of Chlorocebus MC1R provide for understanding human MC1R function?

Genomic and evolutionary analysis of Chlorocebus MC1R can provide valuable insights into functionally critical regions of the receptor that have been conserved through primate evolution. Researchers should consider:

  • Comparative sequence analysis across primate species

  • Identification of conserved versus variable regions

  • Correlation of sequence conservation with functional domains

  • Analysis of selective pressures on different receptor regions

The Chlorocebus genome has been sequenced, with MC1R located on chromosome 19 (NC_023660) . Studies of vervet monkeys have contributed to understanding genetic variation in primates, with relevance to immunodeficiency virus pathology research . When designing evolutionary studies, selective sequencing of rapidly evolving segments (as done for ACR gene exon 5) may be particularly informative . This approach can help identify regions under positive selection that may relate to functional adaptations in different environments.

How do functional polymorphisms in Chlorocebus MC1R compare to known human MC1R variants associated with phenotypic changes?

The analysis of Chlorocebus MC1R polymorphisms in relation to known human variants offers insights into the functional conservation of specific amino acid positions. Human MC1R variants have been well-characterized, with "R" variants (rs1805007, rs1805008, rs1805009) showing considerable impairment of receptor signaling and "r" variants (rs1805005, rs2228479, rs885479) exhibiting milder effects .

When studying Chlorocebus polymorphisms, researchers should:

  • Sequence MC1R from diverse Chlorocebus populations

  • Identify naturally occurring variants and their frequency

  • Introduce equivalent mutations into recombinant constructs for functional testing

  • Compare phenotypic associations (if observable) with those documented in humans

This comparative approach can identify functionally critical residues that, when mutated, produce similar effects across species, versus those that show species-specific effects, potentially revealing differential evolutionary pressures or compensatory mechanisms.

What are the major challenges in expressing and stabilizing recombinant Chlorocebus MC1R, and how can they be addressed?

Expressing stable, functional recombinant MC1R presents several technical challenges:

  • Low expression levels: Optimize codon usage for the expression system and consider using inducible promoters to reduce potential toxicity during expression.

  • Protein misfolding: Include molecular chaperones (e.g., GRP78/BiP) in co-expression systems and optimize culture conditions (temperature, inducer concentration).

  • Receptor instability: Incorporate thermostabilizing mutations identified through alanine-scanning mutagenesis or directed evolution approaches.

  • Aggregation during purification: Use stabilizing ligands during extraction and purification; implement careful detergent screening to identify optimal solubilization conditions.

  • Maintaining native conformation: Consider nanobody-stabilized constructs that lock the receptor in specific conformational states, similar to approaches used for Cryo-EM studies of MC1R .

The recent success in determining Cryo-EM structures of MC1R bound to various ligands suggests that some of these challenges can be overcome through careful optimization of expression and purification conditions .

What analytical methods are most effective for characterizing ligand interactions with recombinant Chlorocebus MC1R?

For comprehensive characterization of ligand interactions with recombinant Chlorocebus MC1R, researchers should employ multiple complementary analytical approaches:

  • Radioligand binding assays: Saturation binding with [125I]-labeled α-MSH to determine Kd and Bmax values; competition binding with unlabeled ligands to determine Ki values.

  • Surface plasmon resonance (SPR): Real-time binding kinetics (kon and koff rates) of ligands to immobilized receptor.

  • Fluorescence-based techniques: FRET or BRET-based assays to monitor conformational changes upon ligand binding.

  • Functional assays: cAMP accumulation assays to correlate binding with signaling efficacy.

  • Thermostability shift assays: To assess ligand-induced receptor stabilization.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify specific protein regions involved in ligand interactions.

When comparing different ligands, it's important to distinguish affinity (binding strength) from efficacy (signaling capacity), as these can vary independently, particularly for biased ligands that may preferentially activate specific signaling pathways.

How can researchers effectively compare data from recombinant MC1R systems with endogenous MC1R in relevant cellular contexts?

Bridging the gap between recombinant systems and endogenous receptor function requires careful experimental design:

  • Matched expression levels: Use inducible expression systems to titrate recombinant receptor levels to match endogenous expression (approximately 700 receptors per cell in melanocytes) .

  • Native membrane environment: Consider reconstitution into lipid nanodiscs with compositions mimicking target cell membranes.

  • Cellular context recapitulation: Express recombinant receptors in relevant cell backgrounds (e.g., MC1R-knockout melanocytes) to provide appropriate signaling machinery.

  • Parallel assay validation: Perform identical functional assays in both recombinant and endogenous systems, including downstream signaling readouts beyond cAMP (e.g., ERK activation, calcium mobilization).

  • Single-cell analysis approaches: Consider techniques like single-cell RNA-seq or mass cytometry to account for heterogeneity in endogenous receptor expression and response.

These approaches help ensure that findings from recombinant systems accurately reflect physiological receptor function and avoid artifacts from overexpression or non-native cellular environments.

How can recombinant Chlorocebus MC1R be utilized to study receptor-mediated immunomodulation in cancer models?

Recombinant Chlorocebus MC1R offers sophisticated approaches to study immunomodulatory functions in cancer contexts:

  • Engineered T-cell systems: Express recombinant wild-type or variant MC1R in tumor-specific T cells to study how receptor signaling modulates anti-tumor immunity.

  • Co-culture systems: Develop complex in vitro models combining MC1R-expressing immune cells with tumor cells to study intercellular communication.

  • Receptor-targeted therapy testing: Screen compounds that modulate MC1R signaling specifically in immune cell populations.

Research has shown that α-MSH via MC1R signaling can augment antitumoral immunity by upregulating the expression of cytotoxic genes and enhancing cytolytic activity in tumor-specific CD8+ T cells . Moreover, the presence of functional versus non-functional MC1R affects cytotoxicity in CD8+ T cells from melanoma patients . These findings suggest that MC1R-targeted approaches could potentially enhance immunotherapy efficacy in cancer treatment.

What experimental designs are recommended for investigating the role of recombinant Chlorocebus MC1R in neuroinflammatory processes?

For studying MC1R in neuroinflammation, researchers should consider these experimental approaches:

  • Microglial activation models: Express recombinant MC1R in microglial cell lines to study how receptor signaling modulates inflammatory responses.

  • Primary neural cell co-cultures: Investigate how MC1R activation on different cell types affects neuroinflammatory communication.

  • Ex vivo brain slice models: Apply recombinant MC1R ligands to study effects on inflammatory responses in intact neural circuits.

  • Pathway dissection approaches: Use specific inhibitors of the MC1R/cAMP/PKA/Nurr1 signaling pathway components to identify critical mediators of anti-inflammatory effects.

Research has shown that MC1R activation through compounds like BMS-470539 reduces neuroinflammation and repairs neurological impairments in neonatal rats with hypoxic-ischemic neurological damage . The anti-inflammatory and neuroprotective effects were mediated through the MC1R/cAMP/PKA/Nurr1 signaling pathway, suggesting this as a promising therapeutic target for conditions like hypoxic-ischemic encephalopathy in newborns .

How can structural biology approaches with recombinant Chlorocebus MC1R advance drug discovery efforts?

Advanced structural biology approaches with recombinant MC1R can significantly accelerate targeted drug discovery:

  • Structure-guided drug design: Utilize the recently determined Cryo-EM structures of MC1R and the MC1R–Gs complexes bound to various ligands to design selective modulators .

  • Computational screening approaches: Perform virtual screening against MC1R structural models to identify novel chemotypes with desired properties.

  • Fragment-based drug discovery: Use biophysical methods (NMR, X-ray) to identify small molecular fragments that bind to specific receptor sites.

  • Allosteric modulator development: Target non-orthosteric binding sites identified in structural studies to develop modulators with improved selectivity profiles.

  • Biased signaling compound design: Leverage structural insights into differential receptor conformations to develop ligands that selectively activate beneficial signaling pathways.

The recent determination of Cryo-EM structures of MC1R complexes with the endogenous hormone α-MSH, the marketed drug afamelanotide, and a synthetic agonist called SHU9119 provides unprecedented opportunities for structure-based drug design . These advances may help overcome the historical challenge of selectivity in melanocortin receptor drug discovery.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.