Recombinant Chlorocebus aethiops Membrane cofactor protein (CD46)

Shipped with Ice Packs
In Stock

Description

Overview of CD46

CD46, also known as Membrane Cofactor Protein (MCP), belongs to the family of complement activation regulator (RCA) proteins and functions as a type I transmembrane glycoprotein . It is widely distributed on most normal cell surfaces, including hematopoietic cell lines, fibroblasts, epidermal cells, endothelial cells, and stellate cells, though expression levels vary between different cell types . CD46 serves as a central component of the innate immune system, protecting autologous cells from complement attack by binding to complement proteins C3b and C4b and acting as a cofactor for their cleavage . This protective function is critical for preventing inappropriate complement-mediated damage to host tissues during immune responses.

CD46 in Chlorocebus aethiops

Chlorocebus aethiops (Green monkey) CD46 has particular significance in research contexts due to its structural and functional properties that make it valuable for comparative studies across primate species. The protein in this species has been assigned the UniProt accession number P79138, confirming its recognition as a distinct protein entity . Studies have demonstrated that erythrocytes from African green monkeys effectively hemagglutinate in the presence of measles virus, indicating functional CD46 expression on their cell surfaces . This characteristic makes Chlorocebus aethiops CD46 particularly useful for understanding species-specific interactions with pathogens.

Importance of Recombinant Production

The recombinant production of Chlorocebus aethiops CD46 provides researchers with a controlled and consistent source of this protein for diverse applications. By utilizing recombinant DNA technology, scientists can produce sufficient quantities of the protein with precise structural characteristics for use in crystallography, binding assays, and therapeutic development. The availability of recombinant CD46 enables detailed studies of its structure-function relationships and facilitates the development of novel therapeutic approaches targeting complement-mediated diseases.

Domain Organization

The extracellular portion of CD46 comprises four short consensus repeats (SCR1-SCR4) that form an elongated structure resembling a hockey stick, with a long shaft and a short blade . Domains SCR1, SCR2, and SCR3 are arranged in a nearly linear fashion, providing the "shaft" of the structure . The expression region typically spans amino acids 35-369, covering the functional extracellular domains of the protein . Following the extracellular domain, CD46 contains a transmembrane region and a cytoplasmic tail that contribute to its membrane anchoring and intracellular signaling functions.

Complement Regulation

The primary function of CD46 is to protect host cells from complement-mediated damage by serving as an intrinsic cofactor for the factor-I-mediated cleavage of C3b and C4b . When C3b is cleaved through this mechanism, it produces the fragment C3bi, which is unable to support further complement activation . Similarly, the cleavage of C4b by factor I and CD46 produces the fragments C4c and C4d; C4c is released into the extracellular environment, while C4d remains attached to the target but is incapable of continuing the complement cascade . This regulatory function is particularly effective in controlling the amplification loop of the alternative pathway of complement activation, thereby preventing excessive complement-mediated inflammation and tissue damage.

Immunomodulatory Functions

Beyond its role in complement regulation, CD46 also functions as a costimulatory factor for T-cells, inducing the differentiation of CD4+ T cells into T-regulatory 1 cells . These T-regulatory 1 cells suppress immune responses by secreting interleukin-10, thereby preventing autoimmunity and maintaining immune homeostasis . Research has demonstrated that high expression of CD46 in individuals who have quit smoking can prevent emphysema and chronic obstructive pulmonary disease caused by autoimmune and inflammatory reactions . This immunomodulatory function highlights CD46's broader role in regulating immune responses beyond its complement-inhibitory activities.

Viral Receptor Function

CD46 serves as a cellular receptor for various pathogens, including select adenoviruses, measles virus, human herpes virus 6 (HHV-6), Streptococci, and Neisseria . Studies using different types of monkey erythrocytes as "natural mutant proteins" have helped define the virus binding regions of CD46 . Erythrocytes from African green monkeys and rhesus macaques demonstrate hemagglutination in the presence of measles virus, while baboon erythrocytes show reduced efficiency due to an Arg-to-Gln mutation at amino acid position 103 in the SCR2 domain . Interestingly, New World monkey erythrocytes fail to hemagglutinate with measles virus because they lack the SCR1 domain entirely . These findings provide valuable insights into the structural determinants of CD46-pathogen interactions.

Recombinant Expression Systems

The production of recombinant Chlorocebus aethiops CD46 requires advanced expression systems that maintain the protein's structural integrity and functional properties. While the specific expression system may vary depending on research requirements, the recombinant protein is typically produced with affinity tags to facilitate purification, though the tag type may be determined during the production process to optimize yield and activity . Expression systems must account for proper protein folding and post-translational modifications, particularly glycosylation, which can significantly impact CD46's functional properties.

Analytical Characterization

The following table summarizes key analytical characteristics of Recombinant Chlorocebus aethiops CD46:

ParameterDescriptionReference
SpeciesChlorocebus aethiops (Green monkey)
UniProt AccessionP79138
Alternative NamesMembrane cofactor protein, CD_antigen=CD46
Gene NamesCD46, MCP
Expression Region35-369
Storage BufferTris-based buffer, 50% glycerol
Recommended Storage-20°C (short-term), -20°C or -80°C (long-term)
Working Storage4°C for up to one week
FunctionComplement regulation, viral receptor

Viral Interaction Studies

The recombinant protein serves as an essential tool for investigating CD46-virus interactions, particularly with measles virus. Researchers have demonstrated that measles virus can be genetically modified to allow entry via cell surface molecules other than CD46, producing recombinant viruses that display alternative targeting domains . These studies provide proof of principle that viruses can be engineered to selectively eliminate cells expressing a targeted receptor and offer insights into the mechanisms of viral entry . By using recombinant CD46 in these investigations, scientists gain a better understanding of the molecular determinants of virus-receptor interactions and potential strategies for developing targeted therapeutic approaches.

Therapeutic Development

The detailed understanding of CD46 structure and function enabled by recombinant protein studies has significant implications for therapeutic development. Researchers have created hybrid proteins consisting of growth factors linked to the measles virus attachment protein hemagglutinin, allowing the virus to enter cells via receptors other than CD46 . This approach demonstrates the potential for developing targeted viral therapies that selectively affect cells expressing specific surface receptors . Additionally, the more than 60 disease-associated mutations identified in CD46, primarily linked to atypical hemolytic uremic syndrome (aHUS), provide potential targets for therapeutic intervention . Recombinant CD46 serves as a valuable resource for screening compounds that might restore normal complement regulation in patients with CD46 mutations.

Comparative Studies Across Species

Future research utilizing recombinant Chlorocebus aethiops CD46 may focus on comparative studies with CD46 from other primate species to elucidate evolutionary adaptations in complement regulation and pathogen interactions. The natural variations observed in CD46 across different primate species, such as the SCR1 deletion in New World monkeys and the Arg-to-Gln mutation in baboon CD46, provide valuable insights into the structure-function relationships of this protein . By comparing recombinant CD46 from various species, researchers can identify critical regions for specific functions and understand how selective pressures have shaped the evolution of this important immune regulator.

Engineered Therapeutic Applications

The ability to produce recombinant CD46 and understand its interactions with pathogens opens avenues for developing engineered therapeutic applications. Studies have already demonstrated that measles virus can be modified to enter cells via alternative receptors, suggesting the potential for developing targeted viral therapies . Future research may focus on creating CD46-based therapeutics that modulate complement activation in diseases characterized by dysregulated complement activity. Additionally, the immunomodulatory functions of CD46 in T cell regulation present opportunities for developing novel approaches to treating autoimmune and inflammatory conditions.

Diagnostic Tool Development

Recombinant Chlorocebus aethiops CD46 can serve as a platform for developing diagnostic tools to detect CD46-binding pathogens or identify CD46 mutations associated with disease. Given the more than 60 disease-associated mutations identified in CD46, primarily linked to atypical hemolytic uremic syndrome, diagnostic assays based on recombinant CD46 could help identify patients with these mutations and guide appropriate treatment strategies . Furthermore, the protein's interaction with various pathogens suggests potential applications in developing diagnostic tests for detecting these infectious agents in clinical samples.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you require a specific format, please specify your preference when placing the order and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference for your own solutions.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
CD46; MCP; Membrane cofactor protein; CD antigen CD46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-369
Protein Length
Full Length of Mature Protein
Species
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Target Names
Target Protein Sequence
CEAPPTFEAMELIGKPKPYYKVGERVDYKCKKGYFYVPPLATHSICDRNHTWLPVSDEGCYREMCPHIRDPLNGEAILANGSYEFGSELHFICNEGYYLIGKDILYCELKDTVAVWSGKPPLCEKILCTPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESMIYCGNNSTWSHAAPECKVVKCRFPVVENGKQISGFGKKFYYKATVMFECDKGYYLNGSDKIVCESNSTWDPPVPKCLKGPRPTYKPPVSNYPGYPKPDEGILDSLDDWVIALIVIVIVVAVAVICVALYRFLQGRKKKGKADGGPEYATYQTKSTPPAEQRG
Uniprot No.

Target Background

Function
Membrane cofactor protein (CD46), also known as complement regulatory protein (CRP), acts as a cofactor for complement factor I, a serine protease that protects autologous cells from complement-mediated injury by cleaving C3b and C4b deposited on host tissue. CD46 may play a role in the fusion of spermatozoa with the oocyte during fertilization. It also functions as a costimulatory factor for T-cells, inducing the differentiation of CD4+ cells into T-regulatory 1 cells. These T-regulatory 1 cells suppress immune responses by secreting interleukin-10, contributing to the prevention of autoimmunity.
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane; Single-pass type I membrane protein.
Tissue Specificity
Present at the membrane of erythrocytes and lymphocytes (at protein level).

Q&A

What is Membrane cofactor protein (CD46) and what is its role in the complement system?

CD46, also known as Membrane cofactor protein (MCP), is a type I transmembrane glycoprotein that belongs to the family of complement activation regulator (RCA) proteins. It functions as an intrinsic cofactor for Factor I-mediated cleavage of C3b and C4b complement components. When CD46 aids in C3b cleavage, it produces C3bi fragments that cannot support further complement activation. Similarly, when facilitating C4b cleavage, it generates C4c (released into extracellular space) and C4d fragments (remains attached to target cells but cannot continue the complement cascade). CD46 is particularly effective in controlling the amplification loop of the alternative pathway of complement activation, thereby protecting host cells from complement-mediated damage .

How does the structure of Chlorocebus aethiops CD46 compare with human CD46?

While the search results don't provide specific structural comparisons between Chlorocebus aethiops and human CD46, human CD46 consists of a 309 amino acid extracellular domain with four short consensus repeats (SCR) and a Ser/Thr/Pro-enriched region, a 23 amino acid transmembrane domain, and a 26 amino acid cytoplasmic domain. Human CD46 shares approximately 50% amino acid sequence identity with mouse and rat CD46 within the extracellular domain . The conservation pattern between human and Chlorocebus aethiops (green monkey) CD46 would be relevant for researchers considering cross-species applications or comparative studies of complement regulation mechanisms.

What are the common expression systems used for recombinant CD46 production?

Based on recombinant human CD46 production protocols, common expression systems likely include mammalian cell lines such as HEK293 or CHO cells, which provide proper post-translational modifications, particularly glycosylation patterns that are crucial for CD46 function. The recombinant human CD46 described in the search results is produced with a C-terminal 10-His tag comprising amino acids Cys35-Asp328 of the protein sequence . For research applications requiring carrier-free preparations, the recombinant protein is typically lyophilized from a 0.2 μm filtered solution in PBS and can be reconstituted at 500 μg/mL in PBS .

How should recombinant CD46 protein be properly reconstituted and stored for maximum stability?

Recombinant CD46 protein should be reconstituted at a concentration of 500 μg/mL in PBS. After reconstitution, the protein should be stored at the recommended temperature, typically -20°C or -80°C. To maintain protein integrity, it's crucial to use a manual defrost freezer and avoid repeated freeze-thaw cycles, as these can degrade the protein structure and reduce activity. The carrier-free version (without BSA) is particularly sensitive to storage conditions. The lyophilized form is typically shipped at ambient temperature, but upon receipt, it should be immediately stored at the recommended temperature for maximum stability .

What functional assays can be used to verify the activity of recombinant CD46?

A key functional assay for verifying CD46 activity is binding analysis with its natural ligands. For example, when human recombinant CD46 is immobilized at 5 μg/mL (100 μL/well), its binding to human C4b can be measured with an ED50 of 2-12 μg/mL . Additional functional assays could include:

  • Factor I cofactor activity assays measuring the cleavage of C3b or C4b in the presence of CD46

  • Cell-based assays evaluating protection from complement-mediated lysis

  • Binding studies with measles virus, as CD46 serves as a receptor for this virus

  • T-cell differentiation assays to assess CD46's costimulatory functions for T-regulatory cell development

What are the critical quality control parameters for recombinant CD46 protein?

Quality control for recombinant CD46 should include:

  • Purity assessment: SDS-PAGE analysis under reducing and non-reducing conditions, with expected bands at 40-67 kDa for human CD46 . The variation in apparent molecular weight is due to glycosylation.

  • Identity confirmation: Western blot analysis using specific anti-CD46 antibodies

  • Functional activity: Binding assays with C3b and C4b

  • Endotoxin testing: To ensure the preparation is suitable for cell culture applications

  • Glycosylation analysis: As proper glycosylation is critical for CD46 function and stability

How has CD46 been utilized in xenotransplantation research models?

CD46 has been extensively studied in xenotransplantation research, particularly in pig-to-primate models. Genetically-engineered pigs expressing human CD46 (GTKO/hCD46) have been developed to overcome xenograft rejection. In studies with baboons as recipients of GTKO/hCD46 pig hepatocytes, researchers monitored the immune response, metabolic function, and survival of transplanted cells. Specifically, baboons received anti-thymocyte globulin (ATG) induction and tapering methylprednisolone, along with different maintenance immunosuppressive regimens (tacrolimus/rapamycin or anti-CD40mAb/rapamycin) .

The survival and function of these xenografts were monitored through:

  • Real-time PCR detection of porcine DNA

  • Real-time PCR for porcine gene expression

  • Pig serum albumin levels measured by ELISA

  • Histological examination of injection sites

  • Anti-nonGal IgM and IgG antibody monitoring by flow cytometry

  • CFSE-mixed lymphocyte reaction

This research has implications for developing "bridging" therapies for patients with acute liver failure awaiting human donor organs.

What specific protocols have been developed to evaluate CD46's role in complement regulation across different species?

To evaluate CD46's role in complement regulation across species, researchers have developed several protocols:

  • Comparative binding assays: Measuring the binding affinity of CD46 from different species to human C3b and C4b using surface plasmon resonance or ELISA-based methods.

  • Functional cofactor activity assays: Assessing the ability of CD46 from various species to serve as a cofactor for Factor I-mediated cleavage of C3b and C4b, with cleavage products analyzed by SDS-PAGE and Western blotting.

  • Cross-species complement inhibition: Evaluating the capacity of Chlorocebus aethiops CD46 to protect cells from complement-mediated lysis when exposed to serum from different species.

  • Xenotransplantation models: As seen in baboon studies with GTKO/hCD46 pig hepatocytes, where monitoring includes PCR detection of porcine DNA, porcine gene expression, and pig serum albumin levels .

How does glycosylation affect CD46 function, and what methods exist to characterize these post-translational modifications?

Glycosylation is critical for CD46 function, affecting protein folding, stability, and binding interactions with complement components. The variable glycosylation patterns explain why human CD46 appears as bands between 40-67 kDa on SDS-PAGE . To characterize these post-translational modifications, researchers can employ:

  • Glycosidase digestion: Treatment with enzymes like PNGase F or Endo H followed by SDS-PAGE analysis to determine N-linked glycosylation patterns.

  • Mass spectrometry: Techniques such as MALDI-TOF or LC-MS/MS to identify specific glycan structures and their attachment sites.

  • Lectin binding assays: Using different lectins with specific glycan binding preferences to characterize the type of glycans present.

  • Glycoproteomic analysis: Combining proteomics with glycan analysis to map glycosylation sites and structures simultaneously.

The impact of glycosylation on function can be assessed by comparing native versus enzymatically deglycosylated CD46 in functional assays measuring complement regulation efficiency.

What is the evidence for CD46 involvement in autoimmune and inflammatory diseases?

CD46 has been implicated in various autoimmune and inflammatory conditions. Studies have demonstrated that CD46 is associated with immune-inflammatory diseases, with one notable example being its role in preventing emphysema and chronic obstructive pulmonary disease (COPD). Research by Sandra et al. found that high expression of CD46 in former smokers provides protection against autoimmune and inflammatory reactions that contribute to these respiratory conditions .

Additionally, more than 60 disease-associated mutations in CD46 have been identified. The majority of these mutations are linked to atypical hemolytic uremic syndrome (aHUS), a rare thrombotic microangiopathic-based disease . These findings suggest that CD46's regulatory function in the complement system is crucial for preventing unwanted inflammation and autoimmunity.

How can recombinant CD46 be utilized in developing therapeutic strategies for complement-mediated disorders?

Recombinant CD46 holds promise for therapeutic applications in complement-mediated disorders through several strategies:

  • Direct complement inhibition: Soluble recombinant CD46 could be administered to inhibit excessive complement activation in conditions like aHUS or other complement-driven inflammatory diseases.

  • Cell therapy approaches: Cells engineered to overexpress CD46 might provide enhanced protection against complement attack when transplanted into patients with complement-mediated disorders.

  • Gene therapy: Delivery of functional CD46 genes to correct mutations in patients with CD46-related diseases.

  • Targeted delivery systems: Conjugating recombinant CD46 to targeting moieties that direct the inhibitory activity to specific tissues experiencing complement-mediated damage.

For research exploring these therapeutic strategies, carrier-free recombinant CD46 preparations would be particularly valuable, as the absence of BSA prevents interference in therapeutic applications .

What is the current understanding of CD46 polymorphisms and their association with disease susceptibility?

While the search results don't specifically address CD46 polymorphisms, the information about disease-associated mutations provides context for this question. More than 60 disease-associated mutations in CD46 have been identified, primarily linked to atypical hemolytic uremic syndrome (aHUS) . These genetic variations likely affect CD46's ability to regulate complement activation effectively.

Researchers investigating CD46 polymorphisms would typically:

  • Perform genetic association studies comparing CD46 variants between patient populations and healthy controls

  • Conduct functional studies to determine how specific polymorphisms affect protein expression, structure, and complement regulatory activity

  • Develop in vitro and in vivo models to assess the impact of these variants on disease pathogenesis

  • Explore potential genotype-phenotype correlations to better understand disease heterogeneity

What are the emerging techniques for studying CD46 interactions with viral pathogens?

CD46 serves as a receptor for various pathogens, including measles virus . Emerging techniques for studying these interactions include:

  • Cryo-electron microscopy: Provides high-resolution structural details of CD46-pathogen complexes without the need for crystallization.

  • CRISPR-Cas9 gene editing: Enables precise modification of CD46 domains to study their role in pathogen binding and entry.

  • Single-molecule imaging techniques: Allows visualization of CD46-pathogen interactions in real-time on living cells.

  • Biosensor technologies: Surface plasmon resonance (SPR) and biolayer interferometry (BLI) provide quantitative measurements of binding kinetics between recombinant CD46 and viral proteins.

  • Humanized mouse models: Expression of Chlorocebus aethiops or human CD46 in mice to study species-specific pathogen interactions in vivo.

These advanced methodologies help researchers understand the molecular basis of CD46-pathogen interactions and develop strategies to block viral entry.

How can multiomics approaches enhance our understanding of CD46 biology and function?

Multiomics approaches provide comprehensive insights into CD46 biology through integration of multiple data types:

  • Genomics: Identifying genetic variants affecting CD46 expression and function through whole-genome sequencing and GWAS studies.

  • Transcriptomics: RNA-seq analysis to understand CD46 isoform expression patterns across different tissues and conditions.

  • Proteomics: Mass spectrometry to identify CD46 protein interactions, post-translational modifications, and expression levels.

  • Glycomics: Specialized techniques to characterize CD46 glycosylation patterns that affect protein function.

  • Metabolomics: Assessing metabolic changes in cells with altered CD46 expression or function.

  • Systems biology: Computational integration of these datasets to model CD46's role in cellular networks and signaling pathways.

This integrated approach allows researchers to understand CD46 function in the broader context of cellular physiology and identify novel therapeutic targets.

What are the challenges and solutions in developing cross-species compatible recombinant CD46 for comparative immunology studies?

Developing cross-species compatible recombinant CD46 presents several challenges:

ChallengeSolution
Species-specific glycosylation patternsUse expression systems that closely mimic the native glycosylation of the target species; alternatively, produce minimally glycosylated core proteins
Variation in protein-protein interactionsDesign chimeric proteins containing conserved functional domains while maintaining species-specific binding regions
Immunogenicity in cross-species applicationsRemove or modify immunogenic epitopes while preserving functional domains
Difficulty in validating cross-species functionalityDevelop standardized assays that can assess function across species barriers
Stability differences between species variantsPerform comparative stability studies and optimize buffer conditions for each species variant

These challenges are particularly relevant when studying Chlorocebus aethiops CD46 in relation to human CD46, as understanding the conservation and divergence in structure and function can provide insights into both basic biology and disease mechanisms. Researchers have addressed some of these challenges in xenotransplantation studies where GTKO/hCD46 pig hepatocytes were transplanted into baboons, demonstrating the feasibility of cross-species applications .

What are common pitfalls in recombinant CD46 purification and how can they be addressed?

Common challenges in CD46 purification include:

  • Protein aggregation: CD46 can form aggregates during purification or storage. This can be mitigated by:

    • Optimizing buffer conditions (pH, salt concentration)

    • Adding stabilizing agents like glycerol or low concentrations of non-ionic detergents

    • Using size exclusion chromatography as a final purification step

  • Variable glycosylation: Heterogeneous glycosylation can affect purification efficiency and protein behavior. Solutions include:

    • Using homogeneous expression systems

    • Incorporating enzymatic deglycosylation if glycans aren't essential for the intended application

  • Low yield: To improve yield:

    • Optimize codon usage for the expression host

    • Test different signal peptides

    • Implement fed-batch or perfusion culture techniques

  • Loss of activity during purification: To preserve activity:

    • Minimize exposure to extreme pH or temperature

    • Include protease inhibitors throughout the purification process

    • Perform activity assays at each purification step to identify problematic conditions

For carrier-free preparations like the recombinant human CD46 described in the search results, special attention to storage conditions is essential, including using a manual defrost freezer and avoiding repeated freeze-thaw cycles .

How can researchers optimize CD46 functional assays to ensure reproducibility across different experimental systems?

To ensure reproducibility in CD46 functional assays:

  • Standardize protein preparation:

    • Use consistent expression systems and purification protocols

    • Verify protein quality by SDS-PAGE before each assay

    • Quantify protein accurately using multiple methods (e.g., Bradford assay and UV spectroscopy)

  • Validate activity in multiple assays:

    • Combine binding assays (like the C4b binding assay with ED50 of 2-12 μg/mL for human CD46) with functional cofactor activity assays

    • Include positive and negative controls in each experiment

  • Control environmental variables:

    • Maintain consistent temperature, pH, and ionic strength

    • Use the same lot of critical reagents when possible

    • Document detailed protocols with all buffer compositions and incubation times

  • Implement quality control measures:

    • Regular testing of reference standards

    • Instrument calibration and maintenance

    • Statistical analysis of assay variability

  • Consider species-specific factors:

    • When working with Chlorocebus aethiops CD46, account for potential differences in optimal conditions compared to human CD46

    • Validate cross-reactivity of antibodies and other detection reagents

What are the best approaches for troubleshooting inconsistent results in CD46-based complement regulation assays?

When facing inconsistent results in CD46-based complement regulation assays, consider this systematic troubleshooting approach:

  • Check reagent quality:

    • Verify the integrity of recombinant CD46 by SDS-PAGE

    • Ensure complement components (C3b, C4b, Factor I) are active

    • Test different lots of key reagents

  • Review assay conditions:

    • Optimize buffer composition (ionic strength, Ca²⁺/Mg²⁺ concentration)

    • Verify pH stability throughout the assay

    • Control incubation time and temperature precisely

  • Examine technical execution:

    • Assess pipetting accuracy and precision

    • Verify washing steps in binding assays

    • Check for edge effects in plate-based assays

  • Consider biological variables:

    • Account for isoform variation if using natural sources

    • Evaluate the impact of glycosylation on activity

    • Test for inhibitors or enhancers in the assay system

  • Implement analytical controls:

    • Include internal standards

    • Perform parallel assays with well-characterized reference materials

    • Use statistical methods to identify outliers and sources of variation

By systematically addressing these factors, researchers can identify and eliminate sources of variability in CD46-based assays.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.