Recombinant Chlorocebus aethiops Potassium voltage-gated channel subfamily S member 1 (KCNS1)

Shipped with Ice Packs
In Stock

Description

Domain Organization

KCNS1 belongs to the electrically silent voltage-gated potassium channel (KvS) subfamily, which cannot form functional homotetramers by themselves. Instead, they require heteromerization with members of the Kcnb (Kv2) superfamily to produce functional channels . This property distinguishes the S subfamily from other Kv channels and is important for understanding their physiological roles.

Table 1: Key Structural Features of Chlorocebus aethiops KCNS1

FeatureDescription
Protein Length529 amino acids (full length)
Major DomainsS1-S6 transmembrane segments; pore region; voltage-sensing domain
Functional AssemblyForms heteromers with Kv2 family members
Unique PropertyElectrically silent as homotetramer; modulates function of Kv2 channels
Key RegionsT1 domain facilitates assembly with other subunits

Expression Systems and Recombinant Production

Recombinant Chlorocebus aethiops KCNS1 can be produced using various expression systems, each with distinct advantages for different applications. Commercial sources provide the protein expressed in several systems with high purity.

Expression Systems

The most commonly used expression systems for recombinant KCNS1 production include:

  1. Bacterial expression (E. coli): Cost-effective, high yield, but may lack post-translational modifications

  2. Yeast: Balance between bacterial and mammalian systems, with some post-translational modifications

  3. Baculovirus-infected insect cells: Better folding and post-translational modifications than bacteria

  4. Mammalian cell expression: Most closely resembles native protein with appropriate post-translational modifications

  5. Cell-free expression systems: Rapid production without cellular constraints

Functional Properties and Physiological Roles

While the functional properties of Chlorocebus aethiops KCNS1 have not been extensively characterized in species-specific studies, research on homologous KCNS1 proteins in other species provides valuable insights into its likely functions.

Ion Channel Activity

KCNS1 belongs to the electrically silent KvS subfamily, meaning it cannot form functional homotetrameric channels. Instead, it heteromerizes with Kv2 family members to form functional channels with altered properties . This heteromerization leads to:

  1. Stabilization of resultant currents

  2. Promotion of closed-state inactivation

  3. Attenuation of neuronal excitability

Role in Pain Processing

Studies using mouse models with KCNS1 knockout have revealed critical roles for this channel in pain processing:

  • KCNS1 is predominantly expressed in myelinated sensory neurons positive for neurofilament-200, including Aδ-fiber nociceptors and low-threshold Aβ mechanoreceptors

  • Ablation of KCNS1 in peripheral neurons results in increased basal mechanical pain sensitivity

  • After neuropathic injury, KCNS1 knockout mice exhibit exaggerated mechanical pain responses and hypersensitivity to both noxious and innocuous cold

  • KCNS1 deletion improves locomotor performance, suggesting augmented proprioceptive signaling

These findings suggest that KCNS1 plays a protective role against pain, and its downregulation may contribute to chronic pain states. Consequently, restoring KCNS1 function in the periphery may help ameliorate mechanical and cold pain in chronic conditions .

Applications in Research

Recombinant Chlorocebus aethiops KCNS1 has several important applications in biomedical research:

Pharmacological Screening

Recombinant KCNS1 serves as a valuable tool for:

  • High-throughput screening of potential modulators

  • Development of pain therapeutics targeting KvS channels

  • Investigation of ion channel modulators as potential analgesics

Disease Modeling

Based on related research, KCNS1 may have implications in:

  • Chronic pain conditions

  • Neurological disorders involving altered membrane excitability

  • Potentially cancer, as related KvS channels (e.g., KCNF1) have been implicated in cancer progression

Chlorocebus aethiops as a Model Organism

Chlorocebus aethiops (African green monkey) represents an important research model with particular relevance to KCNS1 studies.

Relevance in Biomedical Research

African green monkeys are frequently used in biomedical research for several reasons:

  • Close evolutionary relationship to humans

  • Well-characterized physiology and genetics

  • High viability of cells (97% for bone marrow cells)

  • Utility as experimental models for various diseases

Comparative Advantages

When studying ion channels like KCNS1, Chlorocebus aethiops offers advantages over rodent models:

  • Greater similarity to human channel proteins

  • More translatable physiological responses

  • Validated model for cellular and molecular studies

Future Research Directions

Research on Recombinant Chlorocebus aethiops KCNS1 presents several promising avenues for future investigation:

  1. Detailed characterization of heteromeric channels formed with various Kv2 family members

  2. Development of selective modulators targeting KCNS1-containing channels for pain management

  3. Investigation of KCNS1 roles in various neurological disorders

  4. Exploration of potential tissue-specific functions beyond the nervous system

  5. Comparative studies across species to understand evolutionary conservation and divergence of channel function

Recombinant Chlorocebus aethiops KCNS1 represents an important tool for advancing our understanding of ion channel biology and developing novel therapeutic approaches for pain and neurological disorders. Its continued study promises to yield valuable insights into fundamental physiological processes and potential clinical applications.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
KCNS1; Potassium voltage-gated channel subfamily S member 1; Delayed-rectifier K(+ channel alpha subunit 1; Voltage-gated potassium channel subunit Kv9.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-529
Protein Length
full length protein
Species
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Target Names
KCNS1
Target Protein Sequence
MLMLLVRGTHYESLRSKVVLPTPLGGRGTEALVSECPSPDTGIRWRQSDEALRVNVGGVR RLLSARALARFPGTRLGRLQAAASEEQARRLCDDYDAAAREFYFDRHPGFFLGLLHFYRT GHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRLSQPRAWDEDSDTPSSVDPC PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIH SLPEYQAREAAAAVAAVAAGRSPEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF FCHPLNLIDIVSVLPFYLTLLAGVALGDQGGTGGKELGHLGKVVQVFRLMRIFRVLKLAR HSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTV SMTTVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNS NHQEFEDLLSSVDGVSEASLETSRETSQEGRSADLETQAPSEPPHPQMY
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels independently. It can form functional heterotetrameric channels in conjunction with KCNB1 and KCNB2, modulating the activation and deactivation rates of the delayed rectifier voltage-gated potassium channel of KCNB1 and KCNB2.
Protein Families
Potassium channel family, S (TC 1.A.1.2) subfamily, Kv9.1/KCNS1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of KCNS1 in neuronal systems?

KCNS1 (Potassium voltage-gated channel subfamily S member 1) functions as a modulatory subunit that cannot form functional channels independently but must heteromerize with members of the Kcnb (Kv2) superfamily to create functional voltage-gated potassium channels. This interaction stabilizes the resultant currents and promotes closed-state inactivation that attenuates excitability in neurons . Physiologically, KCNS1 appears to be pain protective, as its downregulation has been associated with increased nociceptive signaling and hypersensitivity to mechanical and cold stimuli .

How is KCNS1 expressed in the nervous system of Chlorocebus aethiops?

While specific data on KCNS1 expression patterns in Chlorocebus aethiops is limited in the available literature, comparative studies in other mammals indicate that KCNS1 is abundantly expressed in the dorsal root ganglia (DRG), spinal cord, and brain, but excluded from non-neuronal tissues such as muscle, heart, lung, kidney, and liver . As a non-human primate with close genetic similarity to humans, Chlorocebus aethiops likely exhibits similar expression patterns, making it a valuable model for studying KCNS1 function in neurological contexts .

What is the relationship between KCNS1 and neurological disorders?

Research has identified KCNS1 as one of several key potassium channel genes implicated in temporal lobe epilepsy (TLE). Comparative studies have shown that KCNS1 expression is downregulated in the brain tissue of epilepsy mouse models compared to normal mice, both at transcriptional and translational levels . This downregulation pattern is consistent with human data from public databases. Additionally, genetic analysis has linked KCNS1 polymorphisms to variations in basal pain sensitivity and susceptibility to developing chronic pain conditions, including phantom limb pain, back pain, and HIV-associated pain .

What are the recommended protocols for isolating and purifying recombinant KCNS1 from Chlorocebus aethiops tissue samples?

For isolating KCNS1 from Chlorocebus aethiops tissues, researchers should consider the following protocol adaptations:

  • Tissue collection: For neuronal tissues containing KCNS1, samples should be collected from brain regions or peripheral nervous tissue under strict aseptic conditions, similar to the protocol used for bone marrow collection in Chlorocebus aethiops .

  • Cell lysis and protein extraction: Tissues should be homogenized in appropriate buffer containing protease inhibitors to prevent protein degradation.

  • Protein purification: For recombinant KCNS1, affinity chromatography using tagged proteins is recommended, followed by size exclusion chromatography.

  • Quality assessment: Evaluate protein purity using SDS-PAGE and Western blotting with KCNS1-specific antibodies, and assess functional properties through electrophysiological measurements in expression systems.

  • Storage: Purified proteins should be aliquoted and stored at -80°C with cryoprotectants to maintain stability.

How can functional studies of KCNS1 be conducted in heterologous expression systems?

To study KCNS1 function in heterologous expression systems, researchers should implement the following methodological approach:

  • Co-expression system: Since KCNS1 requires heteromerization with Kcnb (Kv2) family members to form functional channels , co-transfection with appropriate Kcnb constructs is necessary.

  • Cell lines: Chinese Hamster Ovary (CHO), Human Embryonic Kidney (HEK) 293, or Xenopus oocytes are suitable expression systems, with each offering different advantages for electrophysiological studies .

  • Electrophysiological recording: Patch-clamp techniques should be employed to measure channel properties, including activation/inactivation kinetics, conductance-voltage relationships, and response to pharmacological agents.

  • Data analysis: Compare kinetic behaviors between different experimental conditions using normalized current amplitudes and appropriate statistical tests such as t-tests or ANOVA .

  • Temperature considerations: As seen with other potassium channels like Kv1.1, temperature affects channel function, so recordings should be performed at physiologically relevant temperatures (35-37°C) .

What are the challenges of generating antibodies specific to Chlorocebus aethiops KCNS1?

Generating specific antibodies against Chlorocebus aethiops KCNS1 presents several technical challenges:

  • Sequence homology: High conservation of potassium channel sequences across species can lead to cross-reactivity. Researchers should identify unique epitopes specific to Chlorocebus aethiops KCNS1.

  • Membrane protein nature: As a transmembrane protein, KCNS1 contains hydrophobic domains that make antibody generation difficult. Using extracellular domains or unique intracellular regions for immunization improves specificity.

  • Low expression levels: KCNS1's relatively low natural expression requires strategies such as recombinant protein production of specific domains for immunization.

  • Validation: Rigorous validation using multiple techniques is essential, including Western blotting, immunoprecipitation, and immunohistochemistry with appropriate controls (knockout tissue, pre-absorption controls).

  • Monoclonal vs. polyclonal considerations: Monoclonal antibodies offer higher specificity but may have limited epitope recognition, while polyclonal antibodies provide broader epitope recognition but increased risk of cross-reactivity.

How does KCNS1 heteromerization with Kv2 family members affect channel kinetics and neuronal excitability?

KCNS1 forms heteromeric channels with Kv2 family members, significantly altering the electrophysiological properties of the resultant channels:

  • Kinetic modulation: Studies indicate that KCNS1 association with Kv2 members stabilizes the resultant currents and promotes closed-state inactivation, thereby attenuating neuronal excitability . This heteromerization likely creates channels with unique voltage-dependent activation and inactivation properties.

  • Neuronal impact: The heteromeric KCNS1/Kv2 channels contribute to regulating action potential firing frequency and neuronal adaptation. Loss of KCNS1 function in experimental models has been shown to increase sensory neuron excitability, particularly in myelinated sensory neurons .

  • Pathophysiological significance: The altered excitability resulting from KCNS1 downregulation has been linked to mechanical hypersensitivity and increased cold sensitivity, suggesting a role in both acute and neuropathic pain processing . Similarly, its downregulation in epilepsy models indicates potential involvement in seizure susceptibility .

  • Subunit stoichiometry: The precise ratio of KCNS1 to Kv2 subunits likely affects channel properties, with potential for variable compositions in different neuronal populations or under different physiological conditions.

What molecular mechanisms regulate KCNS1 expression in neuropathic pain and epilepsy models?

Research into the regulatory mechanisms controlling KCNS1 expression reveals several potential pathways:

  • Transcriptional regulation: In rat sensory nerves, Kcns1 mRNA is dramatically and rapidly downregulated following nerve injury, with a time course matching the development of pain phenotypes . This suggests active transcriptional repression mechanisms triggered by neuronal injury.

  • Epigenetic factors: Gene set enrichment analysis (GSEA) indicates that KCNS1 is highly linked to cation channel, potassium channel, respiratory chain, and oxidative phosphorylation pathways , suggesting that metabolic factors may influence its expression.

  • MicroRNA regulation: Research has identified a ceRNA network containing seven miRNAs that may regulate KCNS1 expression , potentially providing post-transcriptional control mechanisms.

  • Transcription factor networks: An mRNA-TF network established using KCNS1 and 113 predicted transcription factors suggests complex regulatory control of expression .

  • Pharmacological modulation: Three common small-molecule drugs (enflurane, promethazine, and miconazole) have been identified as potential modulators targeting KCNS1 , which may affect its expression or function.

How do KCNS1 polymorphisms affect susceptibility to neuropathic pain and therapeutic responses in primates?

KCNS1 genetic variations have significant implications for pain processing and treatment response:

What are the optimal experimental conditions for studying KCNS1 electrophysiological properties?

Based on protocols used for related potassium channels, the following conditions are recommended for KCNS1 electrophysiological studies:

  • Expression systems selection:

    • For precise biophysical characterization: Xenopus oocytes provide stable recordings

    • For pharmacological studies: CHO or HEK293 cells offer mammalian cellular environment

    • For neuronal context: Primary neuronal cultures or slice preparations from Chlorocebus aethiops

  • Recording parameters:

    • Temperature control: Maintaining physiological temperature (35-37°C) is critical as channel kinetics are temperature-dependent

    • Solutions: External solution should contain (in mM): 140 NaCl, 5 KCl, 2 CaCl₂, 1 MgCl₂, 10 HEPES, 10 glucose (pH 7.4)

    • Internal solution: (in mM) 140 KCl, 1 MgCl₂, 10 EGTA, 10 HEPES, 5 ATP (pH 7.2)

  • Protocol design:

    • Activation protocols: Step protocols from -80mV holding potential to +70mV in 10mV increments

    • Inactivation protocols: Prepulse from -120mV to +30mV followed by test pulse

    • Co-expression with Kv2 channels is essential as KCNS1 requires heteromerization to form functional channels

How can researchers effectively model KCNS1 dysfunction in Chlorocebus aethiops for studying neuropathic pain?

To model KCNS1 dysfunction in Chlorocebus aethiops for neuropathic pain research:

  • Gene knockdown approaches:

    • RNA interference: Targeted siRNA or shRNA delivery to specific neuronal populations

    • Viral vectors: AAV or lentiviral delivery of CRISPR-Cas9 constructs for precise gene editing

    • Antisense oligonucleotides: For transient knockdown of KCNS1 expression

  • Behavioral assessment protocols:

    • Mechanical sensitivity: von Frey filament testing with appropriate force ranges for primates

    • Cold sensitivity: Cold plate or acetone drop tests with temperature control

    • Locomotor assessment: Rotarod performance to evaluate proprioceptive function

  • Tissue collection and analysis:

    • Apply protocols similar to bone marrow collection methods developed for Chlorocebus aethiops, ensuring proper aseptic technique and animal welfare considerations

    • For electrophysiological analysis: Ex vivo DRG or nerve recordings

    • For molecular analysis: Quantitative PCR and Western blotting to confirm KCNS1 downregulation

  • Ethical considerations:

    • Implementation of refined methods to minimize suffering in accordance with international guidelines for primate research

    • Use of appropriate analgesics (e.g., tramadol hydrochloride 2mg/kg) for post-procedural pain management

What are the advantages and limitations of using Chlorocebus aethiops as a model organism for KCNS1 research compared to rodent models?

Advantages:

  • Phylogenetic proximity to humans: Chlorocebus aethiops has greater genotype compatibility with humans compared to rodents, making it an excellent model for translational research .

  • Neuroanatomical similarities: Primate nervous systems more closely resemble human neuroanatomy, allowing for more accurate modeling of neuropathic pain conditions and epilepsy.

  • Complex behavioral assessment: Primates permit more sophisticated cognitive and behavioral testing relevant to pain perception and epilepsy symptoms.

  • Predictive validity: Drug effects in non-human primates generally translate better to human clinical outcomes, particularly for neurological conditions.

Limitations:

  • Ethical and regulatory challenges: Primate research faces stricter ethical scrutiny and regulatory requirements.

  • Resource intensity: Housing, care, and experimental procedures with Chlorocebus aethiops require specialized facilities and higher costs.

  • Lower throughput: Smaller sample sizes and longer experimental timelines compared to rodent models.

  • Limited genetic tools: Fewer established genetic manipulation techniques compared to mice, though this gap is narrowing with advances in gene editing technologies.

How might targeting KCNS1 provide novel therapeutic approaches for neuropathic pain and epilepsy?

Based on current understanding of KCNS1 function, several therapeutic strategies warrant investigation:

  • Channel enhancers: Compounds that enhance KCNS1 activity may provide analgesia by reducing neuronal hyperexcitability . This approach could be particularly beneficial for treating mechanical and cold pain in chronic pain states.

  • Gene therapy approaches: Restoring physiological KCNS1 expression levels through viral vector-mediated gene delivery could potentially reverse neuropathic pain and reduce seizure susceptibility in epilepsy.

  • Small molecule modulators: Research has identified three common small-molecule drugs (enflurane, promethazine, and miconazole) that target KCNS1 . Further development of these or related compounds could yield selective KCNS1 modulators.

  • Cell-specific targeting: Technologies allowing for cell-type-specific modulation of KCNS1 function could enable precise intervention in pain circuits while minimizing off-target effects.

  • Combination therapies: Since KCNS1 functions in heteromeric channels with Kv2 family members, combinatorial approaches targeting both subunit types might offer synergistic therapeutic benefits.

What are the potential applications of KCNS1 as a biomarker for neurological disorders?

KCNS1 shows promise as a biomarker for several neurological conditions:

  • Genetic screening: KCNS1 polymorphisms could serve as predictive biomarkers for:

    • Risk of developing chronic pain after injury or surgery

    • Susceptibility to specific epilepsy subtypes

    • Likelihood of response to certain analgesic or antiepileptic medications

  • Expression monitoring: Changes in KCNS1 expression levels could indicate:

    • Progression of neuropathic pain conditions

    • Epileptogenesis in at-risk patients

    • Disease activity in temporal lobe epilepsy

  • Functional assessment: Electrophysiological properties of KCNS1-containing channels might serve as:

    • Indicators of treatment efficacy

    • Markers for disease progression

    • Targets for personalized medicine approaches

  • Translational applications: Findings from Chlorocebus aethiops models could facilitate development of human biomarkers with greater predictive validity than those derived from rodent models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.