Recombinant Chlorocebus aethiops Sterol O-acyltransferase 1 (SOAT1)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Chlorocebus aethiops SOAT1

Sterol O-acyltransferase 1 (SOAT1) from Chlorocebus aethiops, commonly known as the African green monkey or vervet monkey, is an enzyme that catalyzes the formation of cholesteryl esters from cholesterol and fatty acids. The recombinant form of this protein is produced through various expression systems for research and diagnostic applications. Chlorocebus aethiops SOAT1 is identified in the UniProt database with the accession number O77760, establishing its position in protein reference databases . This enzyme is classified as EC 2.3.1.26 and is also known by several alternative names including Acyl-coenzyme A:cholesterol acyltransferase 1 (ACAT-1) and Cholesterol acyltransferase 1 .

The African vervet meta-population (Chlorocebus aethiops) consists of five major sub-species, with the Caribbean vervet (Chlorocebus aethiops sabaeus) being particularly significant for research purposes due to its genetic homogeneity and utility in genetic mapping studies . These monkeys have been established as important non-human primate models for investigating various aspects of human health, including cholesterol metabolism disorders and related conditions.

Biochemical Function and Metabolic Role

Chlorocebus aethiops SOAT1, like its homologs in other species, plays a critical role in cholesterol metabolism by catalyzing the formation of fatty acid-cholesterol esters . These cholesteryl esters are less soluble in cell membranes than free cholesterol, facilitating cholesterol storage in cytoplasmic lipid droplets and transport within lipoprotein particles . This enzymatic activity is essential for maintaining cholesterol homeostasis, which is crucial for cellular membrane integrity and function.

Catalytic Mechanism and Substrate Preference

SOAT1 demonstrates specific substrate preferences, particularly showing higher activity toward certain acyl-CoA substrates. Research on mammalian SOAT1 has shown that it preferentially utilizes oleoyl-CoA ((9Z)-octadecenoyl-CoA) as a substrate, exhibiting higher activity toward acyl-CoA substrates with a double bond at the delta-9 position (9Z) compared to saturated acyl-CoA or unsaturated acyl-CoA with double bonds at other positions . While these findings are primarily based on human SOAT1, the high degree of conservation among mammalian SOAT1 proteins suggests similar substrate preferences for Chlorocebus aethiops SOAT1.

The catalytic mechanism of SOAT1 involves several key amino acid residues. Studies on human SOAT1 have identified residues including H460, N421, and W420 as critical for enzymatic activity . The high degree of sequence conservation between human and Chlorocebus aethiops SOAT1 suggests similar catalytic mechanisms and active site architectures.

Physiological Significance

SOAT1 plays a pivotal role in lipoprotein assembly and dietary cholesterol absorption . The enzyme's activity contributes to cholesterol homeostasis by regulating the balance between free cholesterol and cholesteryl esters in cells. Dysregulation of SOAT1 activity has been implicated in various pathological conditions, including atherosclerosis, where accumulation of cholesteryl esters within macrophages and smooth muscle cells is a characteristic feature of early atherosclerotic plaques .

Quaternary Structure

Human SOAT1 has been shown to form tetramers consisting of a dimer of dimers . This quaternary structure is important for the enzyme's function, with disruption of the dimer interface leading to significant loss of enzymatic activity . Given the high sequence similarity, Chlorocebus aethiops SOAT1 likely adopts a similar tetrameric arrangement, with specific regions mediating protein-protein interactions within the complex.

Inhibition Mechanisms

Several compounds have been identified as inhibitors of SOAT1, providing insights into potential regulatory mechanisms and therapeutic strategies. One such inhibitor, CI-976, has been shown to bind inside the catalytic chamber of human SOAT1, blocking accessibility to active site residues including H460, N421, and W420 . Other inhibitors, such as celludinones isolated from the fungal strain Talaromyces cellulolyticus BF-0307, have demonstrated inhibitory effects on both SOAT1 and SOAT2 isozymes .

The table below summarizes key SOAT1 inhibitors and their mechanisms:

InhibitorSourceMechanismSpecificityReference
CI-976SyntheticBlocks access to active site residues (H460, N421, W420)SOAT1
Celludinones A ((±)-1)Talaromyces cellulolyticusUnknownSOAT1 and SOAT2
Celludinone B (2)Talaromyces cellulolyticusUnknownSOAT2 selective
ClonoamideClonostachys sp.UnknownSOAT

Recombinant Production and Research Applications

Recombinant Chlorocebus aethiops SOAT1 proteins are valuable tools for research on cholesterol metabolism, drug discovery, and comparative biochemical studies. These recombinant proteins are produced using various expression systems and are available with different tags and specifications to suit different experimental requirements.

Expression Systems and Protein Properties

Recombinant Chlorocebus aethiops SOAT1 can be produced in various expression systems, each offering different advantages in terms of yield, post-translational modifications, and functional properties. Common expression systems include:

  1. Bacterial systems (E. coli): Typically used for producing protein fragments for structural studies or antibody production

  2. Insect cell systems: Offer improved post-translational modifications compared to bacterial systems

  3. Mammalian cell systems: Provide the most native-like post-translational modifications and folding

Commercial recombinant Chlorocebus aethiops SOAT1 products are typically supplied with specific characteristics, as shown in the table below:

PropertySpecificationNotes
Quantity50 μg (typical)Other quantities may be available
Expression SystemVaries (E. coli, insect cells, mammalian cells)System chosen based on application needs
Tag InformationVaries (His, GST, etc.)Determined during production process
Storage BufferTris-based buffer, 50% glycerolOptimized for protein stability
Storage Conditions-20°C, -80°C for extended storageRepeated freezing and thawing not recommended
Purity>80% (typical)Assessed by SDS-PAGE

Research Applications

Recombinant Chlorocebus aethiops SOAT1 has several important research applications:

  1. Enzyme activity assays: Used to study cholesterol esterification mechanisms and to screen potential inhibitors

  2. Structural studies: Contributes to understanding the three-dimensional architecture of the enzyme

  3. Antibody production: Serves as an antigen for generating specific antibodies for detection and quantification

  4. Comparative biochemistry: Enables comparison of enzymatic properties across species

  5. Drug discovery: Facilitates screening and development of SOAT1 inhibitors as potential therapeutics

Analytical Methods

Several analytical techniques are commonly employed in research involving recombinant Chlorocebus aethiops SOAT1:

  1. ELISA (Enzyme-Linked Immunosorbent Assay): For quantitative detection and analysis

  2. Western blotting: For protein expression analysis and verification

  3. SDS-PAGE: For purity assessment and molecular weight determination

  4. Cell-based assays: For functional studies of SOAT1 inhibitors

  5. Cryo-electron microscopy: For structural determination

Comparative Analysis and Evolutionary Perspectives

Comparative analysis of SOAT1 across different species provides insights into the evolutionary conservation and functional significance of this enzyme. SOAT1 is highly conserved among mammals, reflecting its essential role in cholesterol metabolism.

Sequence Conservation

The high degree of sequence similarity between Chlorocebus aethiops SOAT1 and its homologs in other species suggests strong evolutionary conservation. This conservation is particularly evident in the catalytic domains and regions involved in substrate binding, highlighting their functional importance.

A notable comparative study found that despite the high sequence similarity, there are functional differences between SOAT1 and SOAT2 in terms of sterol specificity. SOAT2 displays significantly greater selectivity for cholesterol compared to sitosterol, whereas SOAT1 shows less discrimination between these sterols . This difference in substrate specificity may reflect the distinct physiological roles of these isozymes.

Chlorocebus aethiops as a Model Organism

Chlorocebus aethiops, particularly the Caribbean vervet (Chlorocebus aethiops sabaeus), serves as a valuable model organism for genetic and biochemical studies relevant to human health. These monkeys are genetically homogeneous and large enough to permit well-powered genetic mapping studies of quantitative traits, including expression quantitative trait loci (eQTL) .

The Caribbean vervet population has been used for linkage and association mapping studies of quantitative traits, with whole genome sequencing enhancing the power of such investigations by providing a comprehensive catalog of genetic variation . This makes Chlorocebus aethiops an important source for studying SOAT1 in a context relevant to human health and disease.

Pathophysiological Implications and Therapeutic Potentials

Understanding the structure and function of Chlorocebus aethiops SOAT1 has significant implications for human health and disease. Dysregulation of SOAT1 activity has been associated with various pathological conditions, including atherosclerosis and metabolic disorders.

Role in Disease Processes

SOAT1 plays a critical role in cholesterol metabolism, and its dysregulation can contribute to pathological conditions. For instance, excessive SOAT1 activity can lead to accumulation of cholesteryl esters in macrophages, contributing to foam cell formation and atherosclerosis development . Conversely, inadequate SOAT1 activity can result in accumulation of free cholesterol, which can be cytotoxic.

In mice, deletion of the Soat1 gene has been shown to affect meibomian glands, which are responsible for producing lipids that prevent evaporation of the eye's tear film. Soat1 knockout mice exhibited abnormal meibum composition, characterized by an upsurge of free cholesterol and an almost complete loss of cholesteryl esters, leading to high melting temperatures of the meibum and associated ocular surface abnormalities .

Therapeutic Potential of SOAT1 Inhibition

Given its role in cholesterol metabolism and disease processes, SOAT1 represents a potential therapeutic target. Inhibitors of SOAT1 have been explored for their potential in treating various conditions, including atherosclerosis and hypercholesterolemia.

Recent structural insights into the inhibition mechanism of human SOAT1 have paved the way for rational drug design targeting this enzyme . Understanding the structural basis of inhibition could facilitate the development of more selective and potent SOAT1 inhibitors with improved therapeutic profiles.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Important: All protein shipments are delivered with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will endeavor to incorporate it into the production process.
Synonyms
SOAT1; ACAT1; Sterol O-acyltransferase 1; Acyl-coenzyme A:cholesterol acyltransferase 1; ACAT-1; Cholesterol acyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-550
Protein Length
full length protein
Species
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Target Names
Target Protein Sequence
MVGEEKMSLRNRLSKSRENPEEDEDQRKPAKESLEAPSNGRIDIKQLIAKKIKLTAEAEE LKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSILEGEKNNHRAKDLRAPPEQGK IFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGK FPTVVWTWWIMFLSTFSVPYFLFQRWATGYSKSSHPLINSLFHGFLFMVFQIGILGFGPT YVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF LFAPTLIYRDSYPRNPTVRWGYVAMQFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSAR VLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTW NVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFM FFGMAFNFIVNDSRKKPIWNVMMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVR PRSWTCRYVF
Uniprot No.

Target Background

Function
Catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol. Plays a role in lipoprotein assembly and dietary cholesterol absorption. Utilizes oleoyl-CoA ((9Z)-octadecenoyl-CoA) preferentially as a substrate. Shows a higher activity towards an acyl-CoA substrate with a double bond at the delta-9 position (9Z) compared to saturated acyl-CoA or an unsaturated acyl-CoA with a double bond at the delta-7 (7Z) or delta-11 (11Z) positions.
Protein Families
Membrane-bound acyltransferase family, Sterol o-acyltransferase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in most tissues, but most strongly in the adrenal gland. Expressed more strongly in liver Kupffer cells than in hepatocytes.

Q&A

What is the primary function of SOAT1 in cellular metabolism?

SOAT1 (Sterol O-acyltransferase 1) is an enzyme that catalyzes the formation of cholesterol esters (CEs) from free cholesterol (FC) and fatty acids, playing a fundamental role in cellular cholesterol homeostasis. This esterification process helps prevent the accumulation of excessive free cholesterol, which can be toxic to cells . SOAT1 activity is particularly important in conditions where cholesterol metabolism is dysregulated, such as in metabolic disorders and cancer. Research has demonstrated that SOAT1 inhibition reduces cellular CE levels and can increase ABCA1-mediated cholesterol efflux, suggesting its critical role in regulating intracellular cholesterol balance .

How does SOAT1 differ from other enzymes involved in lipid metabolism?

SOAT1 belongs to a family that includes SOAT2, but these enzymes exhibit distinct tissue distribution and functional profiles in research models. While SOAT1 has broader tissue expression patterns and is associated with multiple cancer types, SOAT2 shows more restricted expression profiles . Notably, in hepatocellular carcinoma (HCC), SOAT1 mRNA levels are dramatically higher than SOAT2, and SOAT1 amplification is more common than SOAT2 alterations . Unlike enzymes such as DGAT1 and DGAT2 (which primarily esterify diacylglycerols), SOAT1 specifically targets cholesterol for esterification, making it a unique mediator of cholesterol homeostasis . Additionally, SOAT1 functions in a metabolic network with enzymes like CPT1A, which regulates fatty acid oxidation, forming a regulatory feedback loop that maintains lipid balance in cells .

What experimental models are suitable for studying recombinant SOAT1 function?

Several experimental models have proven effective for studying recombinant SOAT1 function. In vitro models include human podocyte cell lines, where SOAT1 inhibition has been shown to increase ABCA1 expression and reduce cytotoxicity . Primary cell cultures derived from experimental animal models, such as primary podocytes from African green monkey kidney tissue, can be established to study SOAT1 activity under various conditions . For in vivo studies, several mouse models have been developed, including SOAT1 knockout mice (Soat1−/−) which demonstrate decreased cholesterol ester content and altered physiological responses . Additionally, disease-specific models such as diabetic nephropathy models (db/db mice) and Alport syndrome mice crossed with SOAT1-deficient mice have been successfully employed to investigate SOAT1's role in disease progression .

What are the molecular mechanisms by which SOAT1 promotes epithelial-mesenchymal transition (EMT) in cancer cells?

SOAT1 promotes EMT in cancer cells through dysregulation of cholesterol metabolism. Research on hepatocellular carcinoma (HCC) has revealed that SOAT1 facilitates EMT by maintaining cholesterol homeostasis through two primary mechanisms: increased cholesterol in the plasma membrane and accumulation of cholesterol esters . These alterations in cholesterol distribution affect membrane fluidity and lipid raft composition, which subsequently influence signaling pathways that drive EMT. Analysis of SOAT1's molecular interactions suggests it activates multiple pathways linked to cancer progression, including PI3K/AKT signaling, IL-18 signaling, calcium signaling, Wnt signaling, and JAK/STAT pathways . The connection between SOAT1 and EMT is further supported by correlation studies showing that SOAT1 expression positively associates with EMT markers in HCC tissues, and experimental models demonstrate that SOAT1 inhibition can reverse the EMT phenotype by normalizing cholesterol metabolism .

How does SOAT1 interact with the immune microenvironment in pathological conditions?

SOAT1 expression significantly influences the tumor immune microenvironment through complex interactions with multiple immune cell populations. Bioinformatic analyses have revealed that SOAT1 expression positively correlates with the abundance of specific immune cells, including macrophages, Th2 cells, T helper cells, CD56bright natural killer cells, and Th1 cells . Conversely, SOAT1 expression negatively correlates with Th17 cells, dendritic cells, and cytotoxic cells . These associations suggest that SOAT1 may modulate immune surveillance and anti-tumor responses by altering the composition and function of tumor-infiltrating immune cells. The mechanisms behind these correlations likely involve SOAT1's role in lipid metabolism, as altered cholesterol homeostasis affects immune cell function, particularly in lipid raft-dependent signaling pathways crucial for immune cell activation and cytokine production. This immunomodulatory role of SOAT1 provides a rationale for combining SOAT1 inhibitors with immunotherapeutic approaches in cancer treatment.

What is the significance of the SOAT1-CPT1A regulatory axis in cellular metabolism?

The SOAT1-CPT1A regulatory axis represents a sophisticated metabolic control mechanism that maintains lipid homeostasis in cells. Bioinformatic analysis has revealed that SOAT1-mediated fatty acid storage and CPT1A-mediated fatty acid oxidation (FAO) form a double-negative feedback loop, particularly in hepatocellular carcinoma . When CPT1A (Carnitine Palmitoyltransferase 1A) is inhibited, excess fatty acids are diverted toward storage in lipid droplets through SOAT1-mediated esterification. Conversely, SOAT1 inhibition enhances CPT1A protein expression, which shuttles the released fatty acids into mitochondria for oxidation . This reciprocal regulation between SOAT1 and CPT1A is particularly critical in cancer cells, which often rely on reprogrammed lipid metabolism to support their growth and survival. Gene expression analysis shows that genes negatively correlated with SOAT1 are primarily involved in fatty acid metabolism, oxidation-reduction processes, and respiratory chain complexes, while CPT1A positively correlates with lipid oxidation and tricarboxylic acid cycle components . This metabolic axis presents a promising target for therapeutic intervention, as simultaneous targeting of both enzymes has demonstrated synergistic anticancer efficacy in HCC models .

What are the optimal conditions for expressing and purifying recombinant Chlorocebus aethiops SOAT1?

The expression and purification of recombinant Chlorocebus aethiops SOAT1 requires careful optimization due to its membrane-associated nature. Based on research protocols with similar proteins, effective expression systems include baculovirus-infected insect cells or mammalian expression systems that can properly fold and post-translationally modify this complex protein. The purification process typically involves detergent solubilization of membranes containing the expressed SOAT1, followed by affinity chromatography using appropriate tags (His, FLAG, or GST) engineered into the recombinant construct. Critical parameters for maintaining SOAT1 activity during purification include pH maintenance between 7.2-7.6, inclusion of glycerol (10-15%) in buffers, and the addition of protease inhibitors to prevent degradation. Activity assays measuring the conversion of radiolabeled cholesterol to cholesterol esters can confirm the functionality of the purified protein. For applications requiring insertion of SOAT1 into artificial membranes, reconstitution into liposomes or nanodiscs has proven effective in maintaining enzymatic activity while providing a controlled lipid environment that mimics physiological conditions.

How can researchers accurately measure SOAT1 enzymatic activity in experimental models?

Accurate measurement of SOAT1 enzymatic activity in experimental models requires methods that specifically quantify the conversion of free cholesterol to cholesterol esters. One established approach involves incubating cell lysates or purified SOAT1 with 14C-labeled oleoyl-CoA and measuring the incorporation of the radioactive label into cholesterol esters through thin-layer chromatography or high-performance liquid chromatography . For in vitro studies using cell cultures, researchers can extract total lipids and separate cholesterol esters from free cholesterol using techniques such as gas chromatography-mass spectrometry (GC-MS) or liquid chromatography-mass spectrometry (LC-MS) . The cholesterol ester content can then be quantified and normalized to total cellular protein.

Alternative methods include fluorescent-based assays using NBD-cholesterol (22-(N-(7-nitrobenz-2-oxa-1,3-diazol-4-yl)amino)-23,24-bisnor-5-cholen-3β-ol) as a substrate, which allows for real-time monitoring of esterification activity. When conducting SOAT1 activity assays, it is crucial to include appropriate controls, such as specific SOAT1 inhibitors (e.g., avasimibe) to confirm the specificity of the measured activity . For in vivo studies, cholesterol ester content in tissues can be quantified following lipid extraction, with particular attention to the kidney cortex or liver tissue depending on the disease model being studied .

What techniques are effective for analyzing SOAT1 expression in tissue samples?

Multiple complementary techniques provide comprehensive analysis of SOAT1 expression in tissue samples. Quantitative real-time PCR (qRT-PCR) effectively measures SOAT1 mRNA levels, allowing researchers to detect changes in expression under different experimental conditions or disease states . This technique has successfully demonstrated increased SOAT1 expression in podocytes exposed to sera from patients with progressive diabetic kidney disease compared to non-progressive cases .

For protein-level analysis, Western blotting with specific anti-SOAT1 antibodies provides quantitative measurement of SOAT1 protein expression and can detect post-translational modifications. Immunohistochemistry (IHC) is particularly valuable for localizing SOAT1 expression within tissue architecture and has been used to create scoring systems (0-3) based on staining intensity and percentage of positive cells . In cancer research, SOAT1 protein expression patterns assessed by IHC have been correlated with clinical outcomes and pathological features . For more precise localization, immunofluorescence combined with confocal microscopy allows co-localization studies with other cellular markers.

For large-scale analysis, tissue microarrays enable simultaneous analysis of SOAT1 expression across multiple tissue samples. Digital pathology tools can then quantify expression patterns using standardized algorithms, reducing subjective interpretation. When analyzing SOAT1 expression data, it is important to normalize to appropriate reference genes or proteins and to include relevant clinical and pathological correlations for meaningful interpretation .

How can SOAT1 inhibition be leveraged in developing therapeutic strategies for kidney disease?

SOAT1 inhibition presents a promising therapeutic approach for kidney diseases, particularly diabetic kidney disease (DKD) and Alport syndrome (AS). Research has demonstrated that SOAT1 inhibition protects podocytes from injury by reducing cholesterol ester (CE) accumulation and increasing ABCA1/APOA1-mediated cholesterol efflux . Several methodological approaches can be implemented to leverage SOAT1 inhibition therapeutically.

Small molecule inhibitors targeting SOAT1, such as the SOAT1 inhibitor (SI) used in experimental models, have shown efficacy in preventing podocyte cytotoxicity and apoptosis when exposed to sera from patients with progressive kidney disease . In vivo studies using genetic models (Soat1−/− mice) have demonstrated improved renal function and reduced disease progression in experimental models of DKD and AS . These models show decreased cholesterol ester content in kidney cortices, increased ABCA1 expression in glomeruli, and decreased mesangial expansion compared to control mice .

The efficacy of SOAT1 inhibition appears to be partially mediated through ABCA1-dependent mechanisms, as demonstrated by experiments with ABCA1 knockdown podocytes where the protective effect of SOAT1 inhibition was reduced . This suggests that combination strategies enhancing both SOAT1 inhibition and ABCA1-mediated cholesterol efflux could provide synergistic therapeutic benefits. The translational potential of this approach is supported by evidence that SOAT1 deficiency preserves podocyte numbers in diabetic models, directly addressing a critical pathological feature of progressive kidney disease .

What is the prognostic value of SOAT1 expression in cancer and how can it guide personalized treatment approaches?

In HCC, SOAT1 expression is also associated with poor prognosis. Bioinformatic analysis revealed that SOAT1 has higher expression in tumor tissues compared to adjacent normal tissues, with an area under the ROC curve of 0.748 when comparing tumor samples to para-carcinoma tissues . This elevated expression correlates with lower survival rates in HCC patients .

The prognostic value of SOAT1 can guide personalized treatment approaches in several ways. For ACC, SOAT1 expression may help identify patients more likely to benefit from mitotane therapy, as SOAT1 is a molecular target for this drug . In HCC, SOAT1 expression correlates with immune cell infiltration patterns, suggesting potential integration with immunotherapy approaches . Patients with high SOAT1 expression might benefit from combination therapies targeting both SOAT1 and immune checkpoints.

Furthermore, the connection between SOAT1 and CPT1A in lipid metabolism suggests that simultaneous targeting of multiple metabolic pathways could be effective in patients with high SOAT1 expression . The combination of SOAT1 inhibitors (like avasimibe) with FAO inhibitors (like etomoxir) has demonstrated synergistic anticancer efficacy in HCC models and represents a promising personalized approach for patients with altered lipid metabolism .

How does SOAT1 contribute to metastasis and what methodological approaches can be used to study this process?

SOAT1 contributes to metastasis primarily through promoting epithelial-mesenchymal transition (EMT), a critical process in cancer cell invasion and metastatic spread. Research on hepatocellular carcinoma has demonstrated that SOAT1 positively correlates with EMT markers and promotes cell migration and invasion in vitro . The underlying mechanism involves SOAT1-mediated disruption of cholesterol metabolism homeostasis, specifically through increased cholesterol in the plasma membrane and accumulation of cholesterol esters .

Several methodological approaches can effectively study SOAT1's role in metastasis. In vitro migration and invasion assays using Transwell chambers or wound-healing assays can quantify the metastatic potential of cancer cells with manipulated SOAT1 expression. These approaches have demonstrated that SOAT1 overexpression enhances migration and invasion capabilities, while SOAT1 knockdown or inhibition reduces these metastatic behaviors .

Molecular analysis of EMT markers (E-cadherin, N-cadherin, Vimentin, etc.) through Western blotting, immunofluorescence, and qRT-PCR provides mechanistic insights into how SOAT1 regulates the EMT program. Membrane cholesterol content can be measured using filipin staining or extraction followed by enzymatic quantification to correlate SOAT1 activity with membrane cholesterol levels, a key factor in EMT signaling .

In vivo metastasis models, including orthotopic xenografts with subsequent analysis of distant organ colonization, offer physiologically relevant systems to study SOAT1's impact on metastasis. These models can be combined with SOAT1 inhibitors or genetic manipulation (knockdown/overexpression) to assess therapeutic potential. Notably, natural compounds like nootkatone have been identified to inhibit EMT by targeting SOAT1 both in vitro and in vivo, providing promising leads for anti-metastatic therapy .

What are the emerging roles of SOAT1 in metabolic reprogramming beyond cholesterol homeostasis?

SOAT1's functions extend beyond cholesterol homeostasis to influence broader aspects of cellular metabolism. Emerging research indicates that SOAT1 plays crucial roles in metabolic reprogramming through its interactions with key metabolic pathways and signaling cascades. Gene Set Enrichment Analysis (GSEA) has revealed that genes negatively correlated with SOAT1 are primarily involved in oxidation-reduction processes and respiratory chain complex activity, suggesting SOAT1 may influence mitochondrial function and energy metabolism .

The interaction between SOAT1 and CPT1A represents a significant metabolic regulatory mechanism, forming a double-negative feedback loop that balances fatty acid storage and oxidation . This regulatory axis has implications for cellular energy production and utilization beyond simple lipid storage. Additionally, SOAT1's role in modulating membrane lipid composition affects numerous membrane-associated signaling pathways, including PI3K/AKT signaling, which is a master regulator of cellular metabolism .

In non-alcoholic fatty liver disease (NAFLD) progression to HCC, SOAT1 appears to contribute to the metabolic adaptations that facilitate tumor development . The enzyme's activity increases in response to high-fat diet conditions, suggesting a role in adapting to nutrient excess and metabolic stress . Future research should explore how SOAT1 interfaces with other metabolic sensing pathways, such as AMPK and mTOR signaling, and investigate its potential roles in regulating autophagy, a key process in cellular adaptation to metabolic stress.

How can structural insights into SOAT1 from Chlorocebus aethiops inform the development of species-specific inhibitors?

Structural analysis of Chlorocebus aethiops SOAT1 can provide valuable insights for developing species-specific inhibitors with enhanced efficacy and reduced off-target effects. Although detailed structural information about SOAT1 is currently limited, comparative sequence analysis between primate species can identify conserved catalytic domains and species-specific variations. These variations may reside in substrate binding pockets or allosteric regulatory sites that could be exploited for selective targeting.

Advanced structural biology techniques, including cryo-electron microscopy and X-ray crystallography of purified recombinant SOAT1, would significantly advance our understanding of the enzyme's three-dimensional structure. Homology modeling based on related enzymes with known structures can provide preliminary structural insights while experimental structures are being determined. Molecular docking studies using these structural models can then identify potential binding sites for inhibitor development.

Site-directed mutagenesis experiments comparing the effects of mutations in conserved versus variable regions between species can validate structural predictions and identify functionally important residues. Enzymatic assays comparing inhibitor efficacy across SOAT1 from different species can establish structure-activity relationships and guide optimization of species-selective compounds. Development of species-specific inhibitors would be particularly valuable for preclinical testing, allowing researchers to predict human responses more accurately based on comparative pharmacology across primate models.

What biomarker panels could be developed that incorporate SOAT1 expression for improved disease stratification?

Integrating SOAT1 expression into comprehensive biomarker panels could significantly enhance disease stratification in multiple conditions. For cancer prognostication, particularly in adrenocortical carcinoma and hepatocellular carcinoma, combining SOAT1 expression with established markers could improve risk stratification. In ACC, SOAT1 could be incorporated with Ki-67 proliferation index and SF-1 expression, which has also shown prognostic value . For HCC, a panel including SOAT1, AFP, and markers of vascular invasion could provide more accurate prognostic information .

For kidney disease progression, combining SOAT1 expression with markers of podocyte injury (nephrin, podocin) and inflammation could help identify patients at higher risk for rapid progression who might benefit from targeted therapies . Using machine learning algorithms to integrate multiple biomarkers, including SOAT1 expression, clinical parameters, and genetic factors, could generate personalized risk scores with higher predictive value than individual markers alone.

Liquid biopsy approaches measuring circulating tumor DNA methylation patterns of SOAT1 or SOAT1 expression in circulating tumor cells could provide minimally invasive monitoring tools. Multi-omics integration of SOAT1 expression with metabolomic profiles (particularly cholesterol derivatives and fatty acids) could provide functional context to expression changes and improve biological interpretation. Development and validation of these integrated biomarker panels would require prospective clinical studies with standardized measurement protocols and appropriate statistical modeling to account for the interactions between multiple markers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.