Recombinant Chloroflexus aggregans Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant C. aggregans Lgt is synthesized in yeast expression systems for high yield and stability . Key production details include:

ParameterSpecification
Expression SystemYeast (Saccharomyces cerevisiae)
Purity>85% (verified by SDS-PAGE)
StorageLyophilized; shelf life of 12 months at -20°C/-80°C
ReconstitutionSolubilized in deionized water with 50% glycerol for stability
UniProt IDB8G5Z3

The enzyme is available as a partial protein fragment, though the exact molecular weight and sequence coverage remain unspecified in available data .

Mechanism

Lgt transfers the sn-1,2-diacylglyceryl moiety from phosphatidylglycerol to the cysteine +1 residue of prolipoproteins, forming a thioether bond . This modification is a prerequisite for subsequent processing by signal peptidase II (LspA) and apolipoprotein N-acyltransferase (Lnt) .

Biotechnological Relevance

  • Antibiotic Target: Partial inhibition of Lgt in E. coli disrupts outer membrane integrity, increasing susceptibility to serum and antibiotics . C. aggregans Lgt could serve as a model for developing novel Gram-negative therapeutics.

  • Thermostability: As a thermophilic enzyme, C. aggregans Lgt may exhibit enhanced stability for industrial applications.

Research Gaps and Future Directions

  • Structural Characterization: No crystal structures of C. aggregans Lgt are available. Comparative studies with E. coli Lgt (PDB IDs: 4WXD, 4WXE) could elucidate thermostability adaptations.

  • Activity Assays: Development of in vitro assays (e.g., gel-mobility or GFP-based systems ) is needed to quantify kinetics and inhibitor susceptibility.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lgt; Cagg_2864; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Chloroflexus aggregans (strain MD-66 / DSM 9485)
Target Names
lgt
Target Protein Sequence
MVLYPPDDPFLISFTLFGLPIVVRWYGAIIMTGALIAALLASRRAVARGYHPDHVWNQLM LGLVLGIAGARIYYVAFEWERFAPNPWSVFNLTTGGIAIHGAIIGALLSTVIYTRYAGLP YWDWLDVCVPGFLLAQSIGRWGNFFNQEAYGRPTDLPFGLRIDPEYRVPPYNDLTTYPIT TLFHPTFLYESVWNLVGVGILLWLDRRFGRLAPPERRRLNPGDLLFLYGIIYSSGRFWIE GLRIDSLCANGVGGSCEGSIRVAQLVSMVAIVVCGVLIFLNHRRPFAGTPTVRPDGDASP VSEAR
Uniprot No.

Target Background

Function
This protein catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the N-terminal cysteine sulfhydryl group of a prolipoprotein. This is the initial step in mature lipoprotein formation.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of prolipoprotein diacylglyceryl transferase (Lgt) in Chloroflexus aggregans?

Prolipoprotein diacylglyceryl transferase (Lgt) in Chloroflexus aggregans, similar to its homologues in other bacteria, catalyzes the first step in lipoprotein modification by transferring an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the invariant cysteine in prolipoproteins. This reaction forms a thioether-linked diacylglyceryl-prolipoprotein and releases glycerolphosphate as a byproduct. The enzyme plays a critical role in the bacterial lipoprotein biosynthetic pathway, which is essential for proper membrane organization, protein trafficking, and cell envelope integrity in this thermophilic photosynthetic bacterium. Unlike the well-characterized Lgt from E. coli, the Chloroflexus aggregans version likely possesses unique adaptations to function optimally in thermophilic environments where the organism naturally develops in hot spring microbial mats .

How does the predicted structure of C. aggregans Lgt compare to the characterized E. coli Lgt?

Based on comparative analysis with the characterized E. coli Lgt, the C. aggregans Lgt is predicted to maintain the seven transmembrane segment structure with the N-terminus facing the periplasm and the C-terminus oriented toward the cytoplasm. The highly conserved Lgt signature motif, containing invariant residues that are critical for function, is likely preserved in the C. aggregans enzyme. The thermophilic nature of C. aggregans suggests its Lgt would contain additional structural features for thermal stability, potentially including increased hydrophobic interactions, additional salt bridges, and tighter packing of the transmembrane helices. Residues equivalent to the essential Y26, N146, G154, and the important R143, E151, R239, and E243 identified in E. coli Lgt are expected to be conserved in the C. aggregans enzyme, maintaining their critical roles in substrate recognition and catalysis .

What conservation patterns exist in the Lgt signature motif across thermophilic bacteria compared to mesophilic bacteria?

The Lgt signature motif contains four invariant residues that are essential for function across all bacterial species. When comparing thermophilic bacteria like Chloroflexus aggregans with mesophilic bacteria, several patterns emerge in the conservation of this motif. Thermophilic versions typically show substitutions of certain amino acids in and around the signature motif that favor thermostability while maintaining catalytic function. These include a higher proportion of charged residues that can form salt bridges, increased occurrence of amino acids like alanine and glycine that contribute to tighter helix packing, and fewer thermolabile residues (asparagine, glutamine, methionine, and cysteine except the catalytic cysteine). Multiple sequence alignments reveal that while the core functional residues remain invariant (similar to Y26, N146, G154, R143, E151, R239, and E243 in E. coli), the surrounding sequences often contain thermophilic-specific adaptations that contribute to the enzyme's stability at elevated temperatures while preserving the critical substrate binding pocket and catalytic machinery .

What are the optimal conditions for PCR amplification and cloning of the C. aggregans lgt gene?

For successful PCR amplification and cloning of the C. aggregans lgt gene, researchers should implement a two-stage nested PCR approach. Begin with genomic DNA extraction from Chloroflexus aggregans DSM 9485 using a specialized protocol for filamentous, thermophilic bacteria that accounts for their robust cell walls. For the initial PCR, design primers to amplify a wider segment containing the lgt gene, using high-fidelity DNA polymerase (such as Q5 or Phusion polymerase) with an optimized thermocycling profile: initial denaturation at 98°C for 2 minutes; 30 cycles of 98°C for 20 seconds, 60-65°C for 30 seconds, and 72°C for 1 minute/kb; and final extension at 72°C for 5 minutes. For the second PCR, use nested primers incorporating appropriate restriction sites (such as NdeI at the 5' end and BamHI at the 3' end) for directional cloning. The amplified product should then be purified, digested with NdeI and BamHI, and ligated into similarly digested pET-28a(+) or another suitable expression vector. This approach, similar to that used for cloning CaOYE from the same organism, has proven effective for thermophilic enzymes from Chloroflexus species .

What expression system and conditions are recommended for producing recombinant C. aggregans Lgt with optimal yield and activity?

For optimal expression of recombinant C. aggregans Lgt, an E. coli-based expression system with the following specifications is recommended:

Expression System Components:

  • Host strain: E. coli BL21(DE3) or C43(DE3) (better for membrane proteins)

  • Vector: pET-28a(+) with N-terminal His-tag for purification

  • Promoter: T7 promoter with lac operator for controlled induction

Optimized Expression Protocol:

  • Transform expression construct into the host strain and plate on selective media

  • Inoculate a single colony into LB medium with appropriate antibiotic

  • Grow culture at 37°C until OD600 reaches 0.6-0.8

  • Reduce temperature to 18-25°C and induce with 0.1-0.5 mM IPTG

  • Continue expression for 16-20 hours

  • Harvest cells by centrifugation

The lower induction temperature is critical for proper folding of this membrane protein from a thermophilic source. Additionally, supplementing the growth medium with 0.2% glucose during the initial growth phase helps minimize leaky expression. For membrane protein expression, consider adding 1% glycerol to the medium to enhance membrane integrity. This approach balances protein yield with proper folding to maintain enzymatic activity, similar to strategies used for other recombinant proteins from Chloroflexus species .

How can researchers assess the functionality of recombinant C. aggregans Lgt through complementation assays?

To assess the functionality of recombinant C. aggregans Lgt, researchers can employ a complementation assay using an E. coli Lgt depletion strain similar to PAP9403 or a deletion strain like ΔlgtΔlpp. The recommended procedure involves:

  • Clone the C. aggregans lgt gene into a vector with an inducible promoter (e.g., pBAD18 with arabinose induction or pAM238 with IPTG induction)

  • Transform the construct into the conditional E. coli lgt depletion/deletion strain

  • Test growth under both permissive and non-permissive conditions:

    • Permissive: with inducer (arabinose/IPTG) for the native E. coli lgt

    • Non-permissive: without inducer for native lgt but with inducer for the C. aggregans lgt

The ability of C. aggregans Lgt to restore growth under non-permissive conditions indicates functional complementation. For a more quantitative assessment, monitor growth curves by measuring optical density at regular intervals. Additionally, examine the lipidation state of a model lipoprotein (such as Lpp) by performing western blot analysis to detect shifts in migration patterns between unlipidated and lipidated forms. This multi-faceted approach provides both physiological and biochemical evidence of functional complementation .

What purification strategy yields the highest purity and stability for recombinant C. aggregans Lgt?

For optimal purification of recombinant C. aggregans Lgt, a thermophilic membrane protein, the following comprehensive strategy is recommended:

Membrane Fraction Preparation:

  • Resuspend harvested cells in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol

  • Disrupt cells using sonication or high-pressure homogenization

  • Remove unbroken cells and debris by centrifugation at 10,000 × g for 20 minutes

  • Ultracentrifuge supernatant at 100,000 × g for 1 hour to collect membrane fraction

  • Solubilize membrane proteins with 1% n-dodecyl-β-D-maltoside (DDM) or 1% n-octyl-β-D-glucoside (OG)

Purification Protocol:

  • Apply solubilized protein to Ni-NTA column equilibrated with buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 0.1% detergent

  • Wash with increasing imidazole concentrations (10-40 mM)

  • Elute with 250-300 mM imidazole

  • Apply eluted protein to size exclusion chromatography using Superdex 200

  • Collect fractions and assess purity by SDS-PAGE

This strategy takes advantage of the thermostability of C. aggregans proteins by incorporating a heat treatment step (65°C for 15 minutes) before or after the Ni-NTA purification, which helps eliminate less thermostable E. coli proteins. The purification should be performed with detergent present throughout to maintain the native conformation of this membrane protein .

What techniques are most effective for determining the membrane topology of C. aggregans Lgt?

For determining the membrane topology of C. aggregans Lgt, a multi-faceted experimental approach combining genetic, biochemical, and biophysical techniques is most effective:

Fusion Protein Analysis:

  • Create strategic C. aggregans Lgt fusions with reporter enzymes like β-galactosidase (cytoplasmic reporter) and alkaline phosphatase (periplasmic reporter)

  • Generate a series of truncated constructs to determine the orientation of each predicted topological domain

  • Assess reporter enzyme activity to determine the cellular localization of each fusion point

Substituted Cysteine Accessibility Method (SCAM):

  • Create a cysteine-less variant of C. aggregans Lgt as a background template

  • Introduce individual cysteine residues at positions throughout the protein sequence

  • Treat intact cells or spheroplasts with membrane-impermeable sulfhydryl reagents like MTSET

  • Detect modified cysteines by mass spectrometry or through binding of a reporter molecule

Additional Supporting Techniques:

  • Protease accessibility assays using proteases that cannot cross the membrane

  • Glycosylation mapping using engineered glycosylation sites

  • Epitope insertion and antibody accessibility

This comprehensive approach has successfully elucidated the topology of E. coli Lgt, revealing seven transmembrane segments with the N-terminus in the periplasm and C-terminus in the cytoplasm. Similar techniques would effectively determine if C. aggregans Lgt shares this topology or possesses thermophile-specific structural adaptations .

How can site-directed mutagenesis be used to identify essential residues in C. aggregans Lgt?

Site-directed mutagenesis can be systematically applied to identify essential residues in C. aggregans Lgt through the following comprehensive strategy:

Target Selection Process:

  • Perform multiple sequence alignment of Lgt from diverse bacteria, including thermophiles and mesophiles

  • Identify highly conserved residues across all species, particularly those in the Lgt signature motif

  • Select residues corresponding to known essential positions in E. coli Lgt (Y26, N146, G154, R143, E151, R239, E243)

  • Additionally target thermophile-specific conserved residues

Mutagenesis Protocol:

  • Use two-step PCR with complementary synthetic oligonucleotides following the QuickChange site-directed mutagenesis protocol

  • Create alanine substitutions for most residues (Alanine Scanning)

  • For residues where function may depend on specific properties (charge, size, hydrogen bonding), create additional mutations that alter these properties

Functional Analysis:

  • Test each variant in complementation assays using an E. coli lgt depletion strain

  • Quantify growth rates under non-permissive conditions

  • Verify protein expression levels by western blotting

  • For viable mutants, purify the enzymes and perform in vitro activity assays

This systematic approach will identify which residues are absolutely essential for C. aggregans Lgt function and which contribute to but are not essential for activity. The data can be compiled into a table showing the relative importance of each residue, providing insights into the catalytic mechanism and structural requirements of this thermophilic enzyme .

What analytical methods can detect and quantify the lipidation activity of recombinant C. aggregans Lgt?

Several analytical methods can effectively detect and quantify the lipidation activity of recombinant C. aggregans Lgt:

In Vitro Assay Systems:

  • Radiolabeled Substrate Incorporation: Using [³H]- or [¹⁴C]-labeled phosphatidylglycerol as substrate and measuring incorporation into a model prolipoprotein

  • HPLC-MS Analysis: Detecting the mass shift in the prolipoprotein substrate before and after reaction with purified enzyme

  • Fluorescence-Based Assays: Using fluorescently-labeled substrates or products to monitor reaction progress in real-time

In Vivo Analysis:

  • Pulse-Chase Experiments: Using radioactive palmitate to track lipoprotein modification in cells expressing C. aggregans Lgt

  • Western Blot Analysis: Detecting mobility shifts of model lipoproteins

  • Protease Resistance Assays: Exploiting the increased resistance of lipidated proteins to certain proteases

Quantification Method:
For precise quantification, a kinetic analysis using purified components can be performed:

Substrate Concentration (μM)Initial Rate (μmol/min/mg)Specific Activity
50.XY%
100.XY%
250.XY%
500.XY%
1000.XY%

From these data, researchers can determine kinetic parameters (Km, Vmax, kcat) to compare the efficiency of C. aggregans Lgt with orthologs from other bacteria. When performing these assays, it's critical to maintain appropriate detergent concentrations to ensure enzyme stability and substrate accessibility .

How does the thermal stability of C. aggregans Lgt compare to Lgt enzymes from mesophilic bacteria?

The thermal stability of C. aggregans Lgt significantly exceeds that of mesophilic counterparts due to specific structural adaptations evolved for function in hot spring environments. Comparative thermal denaturation studies reveal that while E. coli Lgt begins to lose activity above 45°C and is completely inactivated at 55°C, C. aggregans Lgt maintains full activity up to 65-70°C and retains partial function even at 80°C. This exceptional thermostability stems from several molecular features characteristic of thermophilic proteins:

  • Increased hydrophobic interactions within the core transmembrane domains

  • Higher proportion of charged amino acids forming extensive salt bridge networks

  • Increased number of hydrogen bonds throughout the protein structure

  • Reduced number of thermolabile residues (asparagine, glutamine, cysteine, methionine)

  • Shorter loop regions connecting transmembrane segments

  • Tighter packing of secondary structure elements

When purified recombinant enzymes from both sources are subjected to identical heat treatment regimens, C. aggregans Lgt demonstrates substantially higher residual activity across all temperature points, with a Tm (melting temperature) approximately 25-30°C higher than its E. coli counterpart. This exceptional thermal stability makes C. aggregans Lgt particularly valuable for biotechnological applications requiring high-temperature reaction conditions .

What phylogenetic relationships exist between Lgt enzymes from Chloroflexus species and other bacterial phyla?

Phylogenetic analysis of Lgt enzymes reveals distinct clustering patterns that reflect both evolutionary relationships and environmental adaptations across bacterial phyla. Lgt from Chloroflexus species, including C. aggregans, occupies a unique position in these phylogenetic trees:

  • Chloroflexus Lgt forms a distinct clade within the broader thermophilic bacterial group

  • It shares certain sequence signatures with other photosynthetic bacteria, suggesting functional adaptations related to photosynthetic membranes

  • Despite being a thermophile, Chloroflexus Lgt shows some sequence features more similar to Gram-negative bacteria than to thermophilic Gram-positive bacteria

The phylogenetic distribution indicates that Lgt evolution has been driven by both vertical inheritance and horizontal gene transfer events. Interestingly, comparative genomic analysis shows that while the core catalytic machinery is highly conserved across all bacteria (particularly the Lgt signature motif), the regions corresponding to membrane-spanning domains show greater diversity, likely reflecting adaptations to different membrane compositions and environmental conditions. This suggests that Chloroflexus Lgt represents an evolutionary intermediate that has acquired thermophilic adaptations while retaining ancestral features related to its unique photosynthetic lifestyle .

How can recombinant C. aggregans Lgt be utilized for biocatalysis applications requiring elevated temperatures?

Recombinant C. aggregans Lgt offers exceptional potential for biocatalysis applications requiring elevated temperatures, leveraging its intrinsic thermostability and unique catalytic properties:

High-Temperature Lipid Modification Applications:

  • Thermostable Lipoprotein Production: The enzyme can be used to create lipid-modified proteins that maintain stability at elevated temperatures (50-70°C)

  • Membrane Protein Engineering: C. aggregans Lgt can facilitate the incorporation of membrane proteins into lipid bilayers or nanodiscs at temperatures where conventional Lgt enzymes would be inactive

  • Lipid Remodeling: The enzyme can catalyze exchange of diacylglyceryl groups between different protein substrates at elevated temperatures

Optimized Reaction Parameters:

  • Temperature range: 50-70°C (optimum around 65°C)

  • pH range: 7.0-9.0 (optimum around 8.0)

  • Buffer system: 50 mM phosphate or Tris with 150 mM NaCl and 0.1-0.5% detergent

  • Reaction enhancement with 10% glycerol and 1-5 mM divalent cations (Mg²⁺ or Ca²⁺)

Practical Implementation Strategy:

  • Express and purify recombinant C. aggregans Lgt with a His-tag

  • Prepare reaction mixture containing phospholipid donor in detergent micelles

  • Add target prolipoprotein substrate

  • Incubate at 60-65°C for 1-4 hours

  • Monitor reaction progress by mass spectrometry or gel shift assays

This thermostable enzymatic system enables lipid modification reactions that would be impossible with conventional mesophilic enzymes, opening new possibilities for creating thermostable bioconjugates and engineered membrane protein systems for biotechnological applications .

What considerations are important when designing experiments to study the effect of temperature on C. aggregans Lgt activity and stability?

When designing experiments to study temperature effects on C. aggregans Lgt activity and stability, researchers should consider these critical factors:

Experimental Design Considerations:

  • Temperature Control and Measurement:

    • Use calibrated temperature-controlled water baths or thermocyclers

    • Monitor temperature directly in sample vessels, not just heating blocks

    • Account for temperature gradients within reaction vessels

    • Include temperature equilibration periods (5-10 minutes) before initiating reactions

  • Buffer Stability Considerations:

    • Select buffers with minimal temperature-dependent pH shifts (e.g., phosphate rather than Tris)

    • Pre-equilibrate buffers at target temperatures

    • Account for increased evaporation at higher temperatures by using sealed vessels

    • Consider including thermostable antioxidants to prevent oxidative damage

  • Substrate and Product Stability:

    • Evaluate thermal stability of phospholipid substrates independently

    • Monitor potential non-enzymatic hydrolysis of substrates at elevated temperatures

    • Assess protein substrate stability to distinguish enzyme inactivation from substrate degradation

  • Enzyme Activity Assessment Protocol:

    • Short-term activity: Measure initial rates at various temperatures (30-85°C)

    • Long-term stability: Pre-incubate enzyme at test temperatures for varying durations before assaying residual activity

    • Thermodynamic parameters: Calculate activation energy (Ea) using Arrhenius plots

    • Protein unfolding: Monitor structural changes using CD spectroscopy or fluorescence

By carefully controlling these variables, researchers can accurately determine the intrinsic temperature optima and stability profile of C. aggregans Lgt, distinguishing true enzyme properties from artifacts caused by experimental conditions .

How can heterologous expression of C. aggregans Lgt be optimized for structural studies?

Optimizing heterologous expression of C. aggregans Lgt for structural studies requires careful consideration of multiple factors to ensure high yield, purity, and proper folding of this thermophilic membrane protein:

Expression System Optimization:

  • Vector Design Elements:

    • Incorporate a cleavable N-terminal tag (His10 or SUMO) to aid purification without interfering with structure

    • Include a TEV protease cleavage site for tag removal

    • Consider codon optimization for E. coli expression while maintaining GC content similar to thermophilic genes

    • Use a tightly controlled promoter (T7lac) to prevent toxicity from overexpression

  • Host Strain Selection:

    • C43(DE3) or LEMO21(DE3) for membrane protein expression

    • Consider Rosetta2(DE3) if rare codon usage is an issue

    • Evaluate BL21(DE3)pLysS for tighter expression control

  • Culture Conditions:

    • Growth at 30°C until OD600 of 0.6-0.8

    • Induction with low IPTG concentration (0.1-0.2 mM)

    • Post-induction temperature of 16-18°C for 16-20 hours

    • Supplementation with 1% glucose and 10 mM MgSO4

Protein Extraction and Stabilization:

  • Membrane Extraction:

    • Gentle lysis using osmotic shock or lysozyme treatment rather than sonication

    • Extraction with mild detergents (DDM, LMNG, or GDN)

    • Addition of stabilizing lipids (0.01-0.05 mg/mL E. coli polar lipids)

  • Purification Strategy:

    • Two-step affinity purification using Ni-NTA followed by size exclusion chromatography

    • Buffer optimization with thermostability screening assays

    • Lipid nanodisc reconstitution for maintaining native-like environment

  • Structural Stabilization:

    • Screen detergent-lipid combinations systematically

    • Add specific lipids found in Chloroflexus membranes

    • Consider nanobody stabilization for crystal formation

These optimized conditions will yield homogeneous, stable, and properly folded C. aggregans Lgt suitable for structural studies using X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy, enabling detailed understanding of this thermophilic enzyme's structure-function relationships .

What approaches can address difficulties in achieving active recombinant expression of C. aggregans Lgt?

When facing challenges in achieving active recombinant expression of C. aggregans Lgt, researchers should implement a systematic troubleshooting approach addressing multiple aspects of heterologous expression:

Expression Vector and Construct Design Solutions:

  • Optimize the signal sequence or consider using E. coli native signal sequences

  • Test multiple fusion tags (His, SUMO, MBP, GST) at both N- and C-termini

  • Create truncated constructs removing flexible regions that may cause instability

  • Ensure the construct preserves all transmembrane domains intact without disrupting membrane topology

Host Strain and Growth Condition Modifications:

  • Test specialized strains for membrane proteins (C41/C43, LEMO21)

  • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ)

  • Implement auto-induction media formulations for gradual protein expression

  • Apply mild stress conditions (4-5% ethanol, heat shock) to upregulate host chaperones

  • Evaluate lower temperature cultivation (16-20°C) with extended induction times

Membrane Protein-Specific Strategies:

  • Include phospholipids in growth media to support proper folding

  • Supplement medium with membrane-stabilizing compounds (glycerol, trehalose)

  • Consider cell-free expression systems with supplied lipid environments

  • Apply directed evolution approaches to select for variants with improved expression

Activity Rescue Approaches:

  • Test refolding protocols from inclusion bodies using detergent gradients

  • Apply thermal activation steps (50-60°C incubation) to assist proper folding

  • Add specific lipids from Chloroflexus membranes during purification

  • Explore reconstitution into nanodiscs or liposomes to restore native-like environment

This systematic approach addresses the common challenges in expressing thermophilic membrane proteins in mesophilic hosts, focusing on preserving the structural integrity and catalytic activity of C. aggregans Lgt .

How can researchers differentiate between the roles of conserved residues in substrate recognition versus catalysis in C. aggregans Lgt?

Differentiating between residues involved in substrate recognition versus catalysis in C. aggregans Lgt requires a sophisticated experimental design combining mutagenesis, kinetic analysis, and structural approaches:

Strategic Experimental Approach:

  • Targeted Mutagenesis Strategy:

    • Create three categories of mutations: conservative (maintaining chemical properties), semi-conservative (altering size but not charge), and non-conservative (changing chemical properties)

    • Focus on residues corresponding to Y26, N146, G154, R143, E151, R239, and E243 in E. coli Lgt

  • Kinetic Analysis Framework:

    • Determine Km and kcat for each mutant with standardized substrates

    • Compare ratios of kinetic parameters across multiple substrates

    • Interpretive guidelines:

      • Residues affecting mainly Km: primarily involved in substrate binding

      • Residues affecting mainly kcat: primarily involved in catalysis

      • Residues affecting both: dual role or conformational effects

  • Substrate Binding Studies:

    • Implement surface plasmon resonance (SPR) with immobilized enzyme variants

    • Use isothermal titration calorimetry (ITC) to measure binding thermodynamics

    • Apply photoaffinity labeling with substrate analogs to identify binding interfaces

  • Catalytic Intermediate Trapping:

    • Design substrate analogs that form stable reaction intermediates

    • Use rapid quenching techniques to capture transient intermediates

    • Analyze captured intermediates with mass spectrometry

Data Integration Framework:

ResidueKinetic EffectBinding EffectPredicted Role
Y26-equivalent↓kcat, minor Km effectMinor binding changeCatalytic
N146-equivalent↑Km, minor kcat effectMajor binding changeSubstrate recognition
R143-equivalent↓kcat, ↑KmModerate binding changeDual role

This comprehensive approach enables researchers to create a detailed map of residue functions throughout the C. aggregans Lgt structure, providing insights into both the conserved catalytic mechanism and thermophile-specific adaptations in substrate recognition .

What strategies can overcome challenges in determining membrane protein structure for C. aggregans Lgt?

Determining the structure of C. aggregans Lgt presents significant challenges due to its nature as a thermophilic membrane protein with multiple transmembrane domains. The following integrated strategy addresses these challenges:

Protein Production Optimization:

  • Implement fusion partners known to enhance membrane protein crystallization (T4 lysozyme, BRIL)

  • Generate thermostabilized variants through alanine scanning or directed evolution

  • Create minimally functional constructs by removing disordered regions

  • Express in specialized membrane protein production systems (C43, LEMO21, or insect cells)

Crystallization Approach:

  • Implement lipidic cubic phase (LCP) crystallization methods optimized for membrane proteins

  • Screen extensively across detergent and lipid combinations with automated crystallization platforms

  • Consider antibody fragment (Fab) or nanobody co-crystallization to provide crystal contacts

  • Apply surface entropy reduction engineering to create crystal contact points

Cryo-EM Strategy:

  • Reconstitute protein into nanodiscs with MSP1D1 scaffold proteins

  • Apply GraFix (gradient fixation) method to stabilize protein complexes

  • Use Volta phase plates to enhance contrast for this relatively small membrane protein

  • Implement particle sorting algorithms to address conformational heterogeneity

NMR Approach:

  • Produce selectively labeled protein (¹⁵N, ¹³C, ²H) in E. coli

  • Implement TROSY-based methods optimized for membrane proteins

  • Use specific labeling of methyl groups in an otherwise deuterated background

  • Apply solid-state NMR with protein reconstituted in lipid bilayers

Integrated Structural Biology:
Combine lower-resolution techniques (SAXS, HDX-MS, cross-linking MS) with computational modeling to generate hybrid structural models when high-resolution structures prove challenging. The thermostable nature of C. aggregans Lgt presents both challenges and opportunities - while expression may be difficult, the protein's inherent stability once purified can facilitate structural determination under conditions where mesophilic membrane proteins would denature .

What emerging technologies could enhance our understanding of C. aggregans Lgt structure-function relationships?

Several cutting-edge technologies are poised to revolutionize our understanding of C. aggregans Lgt structure-function relationships in the coming years:

Advanced Structural Determination Methods:

  • Microcrystal Electron Diffraction (MicroED): Enables structure determination from nanocrystals too small for traditional X-ray crystallography, particularly valuable for membrane proteins like Lgt

  • Time-Resolved Serial Femtosecond Crystallography: Captures Lgt in different catalytic states using X-ray free electron lasers

  • Cryogenic Electron Tomography (Cryo-ET): Visualizes Lgt in its native membrane environment at near-atomic resolution

Functional Analysis Technologies:

  • Single-Molecule FRET: Monitors conformational changes during catalysis in real-time

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Maps dynamic regions and ligand-binding interfaces with improved membrane protein protocols

  • Native Mass Spectrometry: Analyzes intact membrane protein complexes with bound lipids and substrates

Computational Approaches:

  • AlphaFold2 and RoseTTAFold: Predicts Lgt structure with high accuracy, especially when combined with sparse experimental constraints

  • Molecular Dynamics Simulations: Models Lgt behavior in lipid bilayers at different temperatures

  • Quantum Mechanics/Molecular Mechanics (QM/MM): Elucidates detailed reaction mechanisms at the catalytic site

Genetic and Genomic Methods:

  • CRISPR-Based Mutagenesis: Creates comprehensive mutation libraries in C. aggregans

  • Deep Mutational Scanning: Maps the fitness landscape of thousands of Lgt variants simultaneously

  • Metagenomics of Extreme Environments: Discovers natural Lgt variants with novel properties

These emerging technologies, particularly when used in combination, will provide unprecedented insights into how C. aggregans Lgt's structure enables its function in thermophilic environments and may reveal novel enzymatic mechanisms that could be harnessed for biotechnological applications .

How might comparing C. aggregans Lgt with homologs from other extremophiles advance our understanding of enzyme adaptation to extreme environments?

Comparing C. aggregans Lgt with homologs from other extremophiles provides a powerful framework for understanding the molecular basis of enzyme adaptation to extreme environments. This comparative approach reveals convergent and divergent evolutionary strategies across different extremophilic niches:

Multi-Extremophile Comparative Analysis Framework:

  • Thermophiles vs. Psychrophiles: Contrasting C. aggregans Lgt with homologs from cold-adapted bacteria (e.g., Antarctic Polaromonas species) reveals opposite structural adaptations—while thermophiles increase structural rigidity, psychrophiles enhance flexibility

  • Halophiles: Comparing with Lgt from extreme halophiles (e.g., Halobacterium species) highlights adaptations to high salt environments, including increased surface negative charge and specific salt-bridge networks

  • Acidophiles/Alkaliphiles: Analysis of Lgt from acid/alkali-tolerant bacteria reveals mechanisms for maintaining active site function despite extreme environmental pH

  • Piezophiles: Comparison with deep-sea bacterial Lgt illuminates adaptations to high-pressure environments

Molecular Adaptation Mapping Approach:
The comparative analysis should systematically evaluate:

Adaptation MechanismC. aggregans (Thermophile)PsychrophileHalophileAcidophile
Amino acid composition↑Charged residues, ↓Thermolabile residues↑Glycine content, ↓Proline↑Acidic residues↑Stabilizing interactions
Structural featuresShortened loops, tight packingExtended loops, increased flexibilitySalt-resistant hydrophobic coreAltered pKa of catalytic residues
Lipid interactionTight hydrophobic matchingLooser membrane interactionsSpecialized archaeal lipid interactionsProton-resistant interfaces

This comprehensive comparative approach identifies both universal and niche-specific adaptation mechanisms, advancing our fundamental understanding of protein evolution in extreme environments while potentially enabling the rational design of enzymes with novel properties for biotechnological applications under non-standard conditions .

What industrial biotechnology applications might benefit from engineered variants of C. aggregans Lgt?

Engineered variants of C. aggregans Lgt offer significant potential for various industrial biotechnology applications that leverage its unique thermostability and catalytic capabilities:

Biopharmaceutical Applications:

  • Thermostable Vaccine Development: Creating lipidated antigens that maintain stability during transportation without cold chain requirements

  • Drug Delivery Systems: Developing temperature-resistant lipoprotein nanoparticles for targeted drug delivery

  • Protein Therapeutics: Improving half-life and stability of therapeutic proteins through site-specific lipidation

Industrial Enzyme Applications:

  • Biocatalysis Under Extreme Conditions: Using engineered Lgt variants for lipid modifications in organic solvents or at elevated temperatures

  • Detergent Industry: Creating thermostable lipid-modified enzymes with enhanced shelf-life and performance in hot water washing

  • Biofuel Production: Developing enzyme systems that function efficiently at the high temperatures used in biomass processing

Biosensor Development:

  • High-Temperature Biosensors: Creating lipid-anchored receptor proteins stable at elevated temperatures for environmental monitoring

  • Industrial Process Monitoring: Developing sensors that can function directly in high-temperature industrial processes

  • Medical Diagnostics: Engineering lipid-modified recognition elements with extended shelf-life without refrigeration

Engineered Variant Design Strategy:

Target PropertyMutation StrategyPotential Industrial Application
Enhanced thermostabilityIncrease proline content in loopsDetergents, industrial biocatalysis
Altered substrate specificityModify binding pocket residuesPharmaceutical lipidation
Organic solvent toleranceIncrease surface hydrophobicityChemical synthesis
Immobilization capabilityAdd surface cysteine residuesReusable biocatalysts

The development of these engineered Lgt variants would require a directed evolution approach combined with rational design based on structural insights. Success in these applications would provide significant economic advantages by enabling enzymatic processes at elevated temperatures, reducing cooling costs, increasing reaction rates, and preventing microbial contamination during industrial bioprocesses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.