Recombinant Chloroflexus aurantiacus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Chloroflexus aurantiacus

Chloroflexus aurantiacus is a filamentous anoxygenic phototrophic bacterium well-adapted to life in hot spring microbial mats, typically thriving at temperatures between 50 and 60°C . It exhibits remarkable metabolic versatility, capable of both chemotrophic growth under oxic conditions and phototrophic growth under anoxic conditions . C. aurantiacus employs a unique photosynthetic apparatus, utilizing type II photochemical reaction centers and chlorosomes containing bacteriochlorophylls . Unlike oxygenic phototrophs, Chloroflexus does not produce oxygen during photosynthesis, instead using reduced sulfur compounds or hydrogen as electron donors .

Key Features of Chloroflexus aurantiacus

  • Anoxygenic Photosynthesis: Chloroflexus aurantiacus performs photosynthesis without producing oxygen, utilizing reduced sulfur compounds or hydrogen as electron donors .

  • Thermophilic Nature: It thrives in high-temperature environments, particularly hot springs, with an optimal growth temperature between 50 and 60°C .

  • Metabolic Versatility: Capable of both photoheterotrophic and photoautotrophic growth, C. aurantiacus can fix inorganic carbon via the 3-Hydroxypropionate pathway .

  • Unique Photosynthetic Structures: Possesses type II reaction centers similar to purple bacteria and chlorosomes akin to green sulfur bacteria .

  • Gram-Negative Staining: Despite having a single lipid layer, it stains Gram-negative due to a thin peptidoglycan layer compensated by an S-layer protein .

The Large-conductance Mechanosensitive Channel (MscL)

The Large-conductance Mechanosensitive Channel (MscL) is a crucial protein found in bacteria, acting as a safety valve that opens in response to mechanical stress on the cell membrane . This channel allows ions and small molecules to flow across the membrane, preventing cell lysis due to osmotic shock .

Recombinant MscL from Chloroflexus aurantiacus

Recombinant MscL refers to the MscL protein from Chloroflexus aurantiacus that has been produced using recombinant DNA technology. This involves isolating the gene encoding MscL from C. aurantiacus, cloning it into a suitable expression vector, and then expressing the protein in a host organism such as E. coli . The recombinant protein can then be purified and studied in vitro to understand its structure, function, and mechanism of action.

Importance of Studying Recombinant MscL

Studying recombinant MscL from Chloroflexus aurantiacus offers several benefits:

  • Understanding Mechanosensitivity: Provides insights into how bacteria sense and respond to mechanical stress at the molecular level.

  • Drug Development: MscL is a potential target for developing new antibiotics, as inhibiting its function can lead to bacterial cell death.

  • Biotechnology Applications: MscL can be used in various biotechnological applications, such as drug delivery and biosensing.

Proteomic Analysis of Chloroflexus aurantiacus

Proteomic studies have identified and quantified a large number of proteins expressed by C. aurantiacus under different growth conditions. For example, a proteomic time-course analysis of C. aurantiacus during the transition from chemoheterotrophic to photoheterotrophic growth detected 2520 proteins out of 3934 coding sequences in the genome . This type of analysis can provide valuable information about the expression patterns of MscL and other proteins involved in stress response and adaptation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mscL; Caur_2688; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Target Names
mscL
Target Protein Sequence
MIKEFREFISRGNVIDLAVGVIVGAAFTAIINSLVNDIINPLIGLLVGGRADFSNYFIPL AGQTATTLAEAQAAGPVLAYGSFLTAVINFLLIAFVVFMIVRTVNRMRSKPEAVPPAPPE PTPSERLLAEIRDLLARQG
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane stretch. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of MscL from Chloroflexus aurantiacus?

MscL (Large Conductance Mechanosensitive Channel) from Chloroflexus aurantiacus forms a homopentamer, with each subunit containing two transmembrane regions . The channel functions as a tension-activated protein that responds to stretch forces in the lipid bilayer through a bilayer mechanism involving hydrophobic mismatch and changes in membrane curvature and/or transbilayer pressure profile . Unlike some other bacterial proteins that may exist in multi-protein complexes, MscL channels operate as distinct functional units within the membrane. The gating mechanism involves conformational changes triggered by membrane tension, which can be induced both by osmotic pressure and by adhesion forces when bacteria interact with surfaces .

How does MscL gating differ from other mechanosensitive channels?

MscL (Large conductance) channels require higher membrane tension to gate compared to MscS (Small conductance) channels. Studies in Staphylococcus aureus have demonstrated that MscL channels open at a higher critical adhesion force (approximately 3.5-4.0 nN) compared to MscS channels (approximately 1.2 nN) . This difference in gating threshold is consistent with observations in planktonic E. coli and S. aureus, where the critical gating membrane tension for MscS was found to be two-fold smaller than that required for MscL activation . The larger pore size of MscL allows for the passage of larger solutes and provides greater protection against extreme osmotic shock conditions.

What are the optimal conditions for recombinant expression of C. aurantiacus MscL in E. coli?

For optimal expression of recombinant Chloroflexus aurantiacus MscL in E. coli, the BL21(DE3) strain is typically preferred due to its reduced protease activity and compatibility with T7 promoter-based expression systems. Drawing from successful protein expression approaches used for other C. aurantiacus proteins, such as α-L-rhamnosidase, induction with 0.5-1.0 mM IPTG at mid-log phase (OD600 of 0.6-0.8) followed by expression at 30°C for 4-6 hours often yields good results . Membrane proteins like MscL require careful optimization of expression conditions to prevent inclusion body formation. Using specialized vectors containing fusion tags (such as His6, MBP, or SUMO) can improve solubility and facilitate downstream purification. For membrane protein expression, the addition of 0.5-1.0% glycerol to the culture medium may help stabilize the protein during expression.

What purification strategy yields the highest functional recovery of recombinant MscL?

The purification of functional recombinant MscL requires a membrane protein-specific approach to maintain the protein's native conformation and activity. A recommended strategy involves:

  • Membrane isolation through differential centrifugation following cell lysis

  • Solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations slightly above their critical micelle concentration

  • Affinity chromatography (typically using Ni-NTA for His-tagged proteins)

  • Size exclusion chromatography to separate monomeric and properly assembled pentameric forms

For functional studies, reconstitution into liposomes is often necessary. The choice of lipids is critical, as membrane properties including thickness, stiffness, curvature, and lipid composition significantly affect channel gating behavior . To verify functional recovery, patch-clamp electrophysiology on reconstituted proteoliposomes can confirm channel activity in response to membrane tension.

How can researchers effectively measure MscL channel gating in response to mechanical stimuli?

Measuring MscL channel gating in response to mechanical stimuli requires specialized techniques that can apply controlled membrane tension while simultaneously monitoring channel activity. Several methodologies have proven effective:

  • Patch-clamp electrophysiology: This gold-standard approach uses gigaohm seals on either native membranes or reconstituted proteoliposomes. Negative pressure applied through the patch pipette creates membrane tension that activates MscL, allowing single-channel recordings of opening events.

  • Fluorescent reporter assays: By loading liposomes with self-quenching fluorescent dyes (such as calcein), researchers can monitor dye release upon channel opening. This approach has been successfully used to demonstrate that increasing adhesion forces correlate with greater transmembrane transport through mechanosensitive channels .

  • Atomic force microscopy (AFM): For studies investigating the relationship between adhesion forces and channel gating, AFM can precisely measure the forces required to trigger channel opening. Research has shown that adhesion forces modulate mechanosensitive channel gating by inducing deformation of bacterial cell walls upon adhesion to surfaces .

Table 1: Comparative analysis of methods for studying MscL channel gating

MethodAdvantagesLimitationsSensitivity
Patch-clamp electrophysiologySingle-channel resolution, direct measurement of channel currentsTechnically challenging, requires specialized equipmentHigh (single molecule)
Fluorescent reporter assaysHigher throughput, can be used with reconstituted systemsIndirect measurement, potential interference from other channelsModerate
Atomic Force MicroscopyPrecise measurement of adhesion forces, applicable to living cellsSpecialized equipment, lower throughputHigh (nanonewton range)

What are the critical parameters affecting MscL gating threshold in experimental systems?

The gating threshold of MscL is influenced by several critical parameters that must be carefully controlled in experimental systems:

  • Membrane composition: The lipid environment significantly affects MscL gating, with parameters such as membrane thickness, stiffness, curvature, and lipid type directly influencing channel behavior . Studies have shown that membrane properties can alter the tension required for channel opening by affecting the energetics of the conformational changes associated with gating.

  • Temperature: Like most protein-mediated processes, MscL gating exhibits temperature dependence. Optimal experimental temperatures typically range from 25-37°C, with higher temperatures generally reducing the tension threshold required for gating.

  • Ionic environment: The composition and concentration of ions in the experimental buffer can affect membrane properties and protein-lipid interactions. Physiological concentrations of monovalent and divalent cations should be maintained for results that best reflect in vivo behavior.

  • Protein density in membrane: The concentration of channels in the membrane can influence collective gating behavior through protein-protein interactions and effects on local membrane properties. Controlled reconstitution ratios (protein:lipid) are essential for reproducible results.

  • Cell wall rigidity (for in vivo studies): In bacterial systems, cell wall rigidity affects how external forces are transmitted to the membrane. Research has suggested that deletion of MscL in S. aureus alters cell wall properties, potentially affecting the opposition against deformation and associated membrane tension changes .

How does the thermostability of C. aurantiacus MscL compare with mesophilic bacterial MscL channels?

Chloroflexus aurantiacus is a thermophilic bacterium that grows optimally at temperatures between 50-60°C, suggesting its proteins, including MscL, possess enhanced thermostability compared to mesophilic counterparts. Drawing comparisons with other C. aurantiacus enzymes, such as α-L-rhamnosidase which exhibits optimal activity at 50°C , it's reasonable to expect that C. aurantiacus MscL would maintain structural integrity and function at elevated temperatures.

The thermostability of C. aurantiacus MscL likely derives from several structural adaptations commonly observed in thermophilic proteins:

  • Increased hydrophobic interactions in the protein core

  • Higher proportion of charged amino acids forming additional salt bridges

  • More extensive hydrogen bonding networks

  • Reduced number of thermolabile amino acids (Asn, Gln, Cys, Met)

  • Compact protein folding with fewer surface loops

These thermostabilizing features make C. aurantiacus MscL particularly valuable for structural studies and applications requiring protein stability under challenging conditions. For experimental applications, the thermostability of C. aurantiacus MscL potentially allows for simplified purification protocols and extended storage stability compared to mesophilic MscL variants.

How can site-directed mutagenesis be used to study the gating mechanism of C. aurantiacus MscL?

Site-directed mutagenesis represents a powerful approach for elucidating the molecular details of MscL gating mechanisms. For C. aurantiacus MscL, strategic mutations can provide insights into:

  • Tension-sensing residues: Mutations in the transmembrane domains, particularly at the protein-lipid interface, can alter hydrophobic mismatch sensing and change gating thresholds. This approach can identify key residues involved in mechanosensation.

  • Pore-lining residues: Substitutions of residues that line the channel pore can affect conductance, ion selectivity, and the energetics of the closed-to-open transition.

  • Interface residues between subunits: Mutations at subunit interfaces can reveal how intersubunit interactions contribute to the cooperative nature of channel opening.

For rigorous structure-function studies, researchers should implement a systematic mutagenesis approach:

  • Identify conserved residues through sequence alignment with well-characterized MscL channels

  • Generate point mutations using standard molecular biology techniques

  • Express and purify mutant proteins using optimized protocols

  • Reconstitute channels into liposomes of defined composition

  • Assess functional properties using electrophysiology or fluorescence-based assays

  • Correlate functional changes with structural perturbations

To establish the relationship between sequence variations and gating properties, researchers should analyze multiple parameters including gating threshold, open probability, conductance, and kinetics of channel opening and closing.

How does C. aurantiacus MscL differ from E. coli MscL in terms of structure and function?

While both C. aurantiacus and E. coli MscL channels share the fundamental pentameric architecture with two transmembrane domains per subunit, several notable differences exist due to their evolutionary divergence and adaptation to different environmental niches:

  • Thermostability: C. aurantiacus MscL, derived from a thermophilic organism, likely possesses enhanced thermal stability compared to E. coli MscL, allowing function at elevated temperatures similar to other C. aurantiacus enzymes that show optimal activity around 50°C .

  • Sequence variations in tension-sensing regions: The transmembrane domains that interface with the lipid bilayer likely contain adaptations specific to the native membrane environment of each organism. These variations can affect the sensitivity to membrane tension and the gating threshold.

  • Cytoplasmic domains: Differences in the cytoplasmic regions may reflect adaptation to different cytoplasmic environments and potential interactions with other cellular components.

Studies on mechanosensitive channels have shown that gating occurs through a bilayer mechanism involving hydrophobic mismatch and changes in membrane curvature . The specific adaptations in C. aurantiacus MscL would be expected to optimize this mechanism for the thermophilic lifestyle of the organism.

What evolutionary insights can be gained from studying thermophilic MscL channels like those from C. aurantiacus?

Studying thermophilic MscL channels from C. aurantiacus provides valuable evolutionary insights into both protein adaptation and the conservation of mechanosensing mechanisms:

  • Molecular adaptations to extreme environments: By comparing the sequences and structures of MscL channels from thermophiles like C. aurantiacus with mesophilic counterparts, researchers can identify specific adaptations that confer thermostability while preserving mechanosensitive function.

  • Conservation of mechanosensing mechanisms: The fundamental mechanism of mechanosensation through the lipid bilayer appears conserved across diverse bacterial species . Comparative studies can reveal which structural elements are essential for mechanosensation versus those that are adaptable.

  • Evolutionary relationships between mechanosensitive channels: Phylogenetic analysis incorporating thermophilic MscL sequences can help reconstruct the evolutionary history of these channels and their relationship to other ion channels.

  • Convergent evolution: By examining if similar adaptations have occurred independently in different thermophilic lineages, researchers can identify patterns of convergent evolution in response to similar selective pressures.

The study of C. aurantiacus MscL contributes to our understanding of how fundamental cellular processes like osmoregulation are maintained across diverse environments while adapting to specific ecological niches.

How does MscL interact with the bacterial cell wall and what implications does this have for osmoregulation?

The interaction between MscL and the bacterial cell wall represents a critical aspect of bacterial osmoregulation and mechanical stress response. Recent research has illuminated several important aspects of this relationship:

  • Force transduction: The cell wall plays a crucial role in transmitting external mechanical forces to the cytoplasmic membrane where MscL resides. Studies have shown that adhesion forces modulate mechanosensitive channel gating by inducing cell wall deformation upon bacterial adhesion to surfaces .

  • Regulatory feedback: Evidence suggests a bi-directional relationship between MscL and cell wall properties. Research with a ΔmscL mutant in S. aureus demonstrated altered cell wall rigidity, suggesting that "due to the absence of MscLs in the membrane of the ΔmscL mutant, cell wall rigidity and its opposition against deformation" may be affected .

  • Coordinated response to osmotic challenge: During hypoosmotic shock, the bacterial cell wall must accommodate volume changes while MscL channels open to release solutes. This coordination is essential for preventing cell lysis.

The physiological relevance of this interaction is particularly evident during bacterial adhesion to surfaces, where studies have shown that "adhesion forces play an important mechano-microbiological role in gating of mechanosensitive channels and suggests that they could play a role in surface sensing" . This surface sensing capability may contribute to the initial stages of biofilm formation and bacterial colonization.

What is the relationship between MscL expression and bacterial stress response pathways?

MscL expression is integrated with bacterial stress response pathways, serving as both an effector of stress responses and a subject of stress-induced regulation:

  • Transcriptional regulation: Studies have shown that "during the stationary phase and during osmotic shock the channel protein is up-regulated to prevent cell lysis" . This regulation suggests coordination with global stress response regulators such as alternative sigma factors.

  • Integration with osmotic stress responses: MscL functions alongside other osmoregulatory systems, including compatible solute transporters and biosynthetic pathways, to maintain cellular homeostasis during osmotic fluctuations.

  • Role in antibiotic resistance: Research has demonstrated connections between mechanosensitive channels and antibiotic uptake/efflux. For instance, studies in S. aureus showed that "transmembrane transport of both calcein and dihydrostreptomycin was relatively low in the ΔmscL mutant, presumably due to absence of large channels" . This suggests potential involvement in antibiotic resistance mechanisms.

  • Potential as an antibiotic target: The essential role of MscL in bacterial survival under osmotic stress has led to interest in targeting these channels for antimicrobial development. As noted in the literature, "pharmacological potential of MscL may involve discovery of new age antibiotics to combat multiple drug-resistant bacterial strains" .

Understanding the regulatory mechanisms controlling MscL expression and how they intersect with other stress response pathways provides insights into bacterial adaptation to environmental challenges and potential vulnerabilities that could be exploited for antimicrobial development.

What are the main challenges in achieving functional reconstitution of recombinant MscL and how can they be overcome?

Functional reconstitution of recombinant MscL presents several technical challenges that must be addressed to obtain physiologically relevant data:

  • Maintaining protein stability during purification:

    • Challenge: MscL can denature or aggregate during extraction from membranes and purification.

    • Solution: Use mild detergents like DDM or LDAO at concentrations just above CMC; include stabilizing agents such as glycerol (10-15%); maintain samples at 4°C throughout purification; consider adding specific lipids during solubilization.

  • Achieving proper insertion orientation in liposomes:

    • Challenge: Random orientation during reconstitution can complicate functional studies.

    • Solution: Utilize reconstitution methods involving detergent removal by dialysis or bio-beads at controlled rates; optimize protein-to-lipid ratios (typically 1:100 to 1:1000 by weight).

  • Creating physiologically relevant membrane tension:

    • Challenge: Mimicking the natural tension stimuli in vitro.

    • Solution: For patch-clamp studies, use pressure ramps rather than steps to identify precise gating thresholds; for liposome assays, employ osmotic gradients with careful control of solution composition.

  • Variability in lipid composition effects:

    • Challenge: Different lipid environments significantly alter gating properties.

    • Solution: Systematically test defined lipid compositions; consider matching reconstitution lipids to the native environment of C. aurantiacus membranes; examine effects of membrane thickness, charge, and fluidity independently.

  • Distinguishing protein-specific from membrane-based effects:

    • Challenge: Separating direct protein functionality from membrane property changes.

    • Solution: Include appropriate controls with inactive channel mutants; compare with other mechanosensitive channels under identical conditions; use complementary techniques like EPR spectroscopy to monitor protein conformational changes directly.

A systematic approach addressing these challenges will yield more reliable and physiologically relevant data on recombinant MscL function.

What advanced imaging techniques are most effective for studying MscL dynamics in membranes?

Advanced imaging techniques offer powerful approaches for investigating MscL dynamics in membrane environments, each with specific advantages for different research questions:

  • High-Speed Atomic Force Microscopy (HS-AFM):

    • Application: Visualizing conformational changes of MscL in lipid bilayers in real-time at nanometer resolution.

    • Advantage: Can directly observe channel opening/closing events in response to membrane tension.

    • Methodology: Reconstitute MscL in supported lipid bilayers; image under varying tension conditions created by the AFM tip or osmotic pressure.

  • Single-Molecule Fluorescence Resonance Energy Transfer (smFRET):

    • Application: Measuring distances between labeled residues during gating transitions.

    • Advantage: Provides dynamic information about protein conformational changes with sub-nanometer sensitivity.

    • Methodology: Introduce fluorophore pairs at strategic positions; measure FRET efficiency changes during channel activation.

  • Cryo-Electron Microscopy (cryo-EM):

    • Application: Determining high-resolution structures of MscL in different conformational states.

    • Advantage: Can capture multiple conformational states in a single sample.

    • Methodology: Vitrify samples under different tension conditions; use classification algorithms to identify distinct conformational states.

  • Super-Resolution Microscopy (STORM/PALM):

    • Application: Visualizing MscL distribution and clustering in native or reconstituted membranes.

    • Advantage: Overcomes diffraction limit to provide nanoscale spatial resolution.

    • Methodology: Label MscL with photoactivatable fluorophores; acquire and analyze single-molecule localizations.

  • Correlative Light and Electron Microscopy (CLEM):

    • Application: Combining functional fluorescence imaging with structural EM.

    • Advantage: Links functional states observed by fluorescence to structural contexts.

    • Methodology: Perform live-cell fluorescence imaging followed by sample preparation for EM of the same specimen.

Table 2: Comparison of imaging techniques for studying MscL dynamics

TechniqueSpatial ResolutionTemporal ResolutionSample EnvironmentKey Information Provided
HS-AFM1-2 nm100-500 msSupported lipid bilayersTopographical changes during gating
smFRET2-8 nm (distance measurements)1 ms - 1 sSolution or tethered vesiclesProtein conformational dynamics
Cryo-EM2-4 ÅStatic (snapshots)Vitrified samplesHigh-resolution structural states
STORM/PALM20-30 nmMinutes (for full image)Fixed cells or reconstituted systemsSpatial organization and clustering
CLEM20-30 nm (fluorescence), 2-4 nm (EM)Varies by componentCells or reconstituted systemsStructure-function relationships

How might heterologous expression of thermophilic MscL enhance membrane protein research methodologies?

Heterologous expression of thermophilic MscL from Chloroflexus aurantiacus offers several methodological advantages that could significantly advance membrane protein research:

  • Enhanced thermal stability for structural studies: Thermophilic proteins often retain their native fold at higher temperatures, making them more amenable to crystallization and structural determination. This property could facilitate obtaining high-resolution structures of MscL in different conformational states, providing crucial insights into the gating mechanism.

  • Improved purification yields: The inherent stability of thermophilic proteins typically results in better expression and purification yields. By optimizing expression conditions similar to those used for other C. aurantiacus proteins (e.g., α-L-rhamnosidase expressed in E. coli BL21) , researchers could potentially achieve higher functional protein yields.

  • Development of robust biosensors: The thermal and chemical stability of thermophilic MscL makes it an excellent scaffold for engineering tension-sensitive biosensors that can function under harsh conditions. These biosensors could be developed by introducing site-specific modifications to alter gating thresholds or to couple gating with optical or enzymatic outputs.

  • Model system for membrane protein folding studies: Thermophilic membrane proteins can provide valuable insights into the principles governing membrane protein folding and stability. The study of C. aurantiacus MscL folding pathways could reveal generalizable principles applicable to other membrane proteins.

  • Platform for developing membrane protein stabilization strategies: Comparative analysis between thermophilic and mesophilic MscL could identify specific structural features contributing to stability, which could then be applied to stabilize other membrane proteins of interest.

What potential does MscL hold as a target for developing novel antimicrobial compounds?

MscL holds significant promise as a target for novel antimicrobial development, with several compelling advantages and potential strategies:

  • Essential role in bacterial survival: MscL plays a critical role in protecting bacteria from osmotic shock, particularly during transitions between different environments. As noted in the literature, "pharmacological potential of MscL may involve discovery of new age antibiotics to combat multiple drug-resistant bacterial strains" . Compounds that interfere with proper channel function could potentially compromise bacterial survival during environmental transitions.

  • Unique gating mechanism: The mechanosensitive gating mechanism of MscL involves specific protein-lipid interactions and conformational changes that could be targeted by small molecules. Compounds that either lock the channel in an open state (causing unregulated solute leakage) or prevent channel opening (increasing susceptibility to osmotic lysis) could both be effective antimicrobial strategies.

  • Involvement in antibiotic uptake: Research has demonstrated that MscL channels contribute to the uptake of certain antibiotics, including dihydrostreptomycin . Compounds that modulate MscL gating could potentially enhance the efficacy of existing antibiotics by increasing their cellular uptake.

  • Bacterial surface sensing: Evidence suggests that MscL channels respond to surface adhesion forces and may play a role in surface sensing . Interfering with this process could potentially disrupt initial attachment during biofilm formation, offering a novel antibiofilm strategy.

  • Differences from mammalian mechanosensitive channels: While mechanosensitive channels exist in mammalian cells, they differ significantly in structure and gating properties from bacterial MscL. These differences provide a basis for selective targeting of bacterial channels without affecting host cells.

Promising approaches for MscL-targeted antimicrobial development include: screening for compounds that alter gating threshold, designing peptides that interact with the channel pore, and developing lipid-like molecules that specifically alter the lipid-protein interface crucial for mechanosensation.

How can recombinant MscL be utilized in nanotechnology and biosensor development?

Recombinant MscL offers unique properties that make it valuable for various nanotechnology and biosensor applications:

  • Tension-responsive nanovalves: The large pore size of MscL (~30 Å when fully open) and its precise response to membrane tension make it an ideal candidate for developing controllable nanovalves. By reconstituting MscL into liposomes containing encapsulated compounds, researchers can create tension-responsive delivery systems that release their contents only under specific mechanical conditions.

  • Engineered biosensors for mechanical forces: Through site-directed mutagenesis, MscL can be engineered to respond to specific tension thresholds. By coupling this mechanical sensitivity with fluorescent reporters (through genetic fusion or chemical modification), researchers can develop biosensors that translate mechanical stimuli into optical signals. These biosensors could be particularly valuable for studying cellular mechanics and tissue development.

  • Hybrid biomolecular-electronic interfaces: MscL channels reconstituted into supported lipid bilayers on electrode surfaces can serve as transducers that convert mechanical stimuli into measurable electrical signals. Such systems could form the basis of highly sensitive pressure or force sensors for various applications.

  • Single-molecule analytical devices: The large conductance of MscL (~3 nS) makes it suitable for single-molecule detection applications. Modified MscL channels could potentially be used to detect and analyze large molecules as they pass through the pore, similar to nanopore sequencing approaches.

  • Mechanically gated biocatalysis: By fusing catalytic domains to MscL in a conformation-dependent manner, researchers could develop systems where enzymatic activity is regulated by mechanical tension, creating mechanically controlled biocatalysts.

These applications leverage the unique properties of MscL—large conductance, precise mechanical gating, and amenability to engineering—to create novel tools at the interface of biology and technology.

What insights can MscL research provide for understanding eukaryotic mechanosensitive channels and mechanobiology?

Research on bacterial MscL provides valuable comparative insights for understanding more complex eukaryotic mechanosensitive channels and broader principles of mechanobiology:

  • Fundamental mechanisms of mechanosensation: Despite structural differences, bacterial MscL and eukaryotic mechanosensitive channels share the fundamental challenge of converting mechanical force into protein conformational changes. Studies showing that MscL gates "via the bilayer mechanism evoked by hydrophobic mismatch and changes in the membrane curvature and/or transbilayer pressure profile" provide insights into how membrane properties influence channel activity—principles that may apply to eukaryotic channels as well.

  • Membrane-protein interactions: Research demonstrating that "gating in reconstituted channels in liposomes or spheroplasts depended on membrane properties like membrane thickness, stiffness, curvature, and type of lipids" illuminates how the lipid environment modulates mechanosensitive channel function. These findings inform studies of eukaryotic channels, where lipid microdomains and membrane heterogeneity play critical roles.

  • Integration of mechanical signals with cellular responses: The finding that "adhesion forces play an important mechano-microbiological role in gating of mechanosensitive channels and suggests that they could play a role in surface sensing" provides insights into how mechanical forces from the extracellular environment are transduced to influence cellular behavior—a fundamental process in eukaryotic mechanobiology.

  • Evolutionary conservation and divergence: Comparative analysis between prokaryotic and eukaryotic mechanosensitive systems reveals which mechanosensing mechanisms have been conserved throughout evolution and which represent specialized adaptations. This evolutionary perspective helps identify core principles of mechanobiology.

  • Methodological approaches: Techniques developed for studying bacterial MscL, including membrane tension manipulation and high-resolution structural analysis, provide valuable methodological frameworks that can be adapted for studying more complex eukaryotic mechanosensitive systems.

By serving as a well-characterized model system, MscL research continues to inform our understanding of mechanobiology across all domains of life, from basic principles of protein-membrane interactions to complex cellular responses to mechanical stimuli.

What are the most promising directions for engineering C. aurantiacus MscL for biotechnological applications?

The unique properties of C. aurantiacus MscL, particularly its thermostability and mechanosensitivity, position it as an excellent platform for protein engineering with several promising research directions:

  • Tunable tension sensitivity: Engineering MscL variants with altered gating thresholds through targeted mutations in the transmembrane domains would enable the development of biosensors responsive to specific ranges of mechanical force. By systematically altering the hydrophobic interfaces between the protein and membrane, researchers could create a library of channels with precisely defined mechanosensitivity.

  • Ligand-gated MscL variants: Introducing specific binding sites for chemical ligands could transform MscL into a dual-responsive channel that opens in response to both tension and chemical signals. This approach could yield bioswitches for controlled release applications with multiple regulatory inputs.

  • Substrate-selective channels: Modifying the pore region of MscL through site-directed mutagenesis could generate channels with selectivity for specific molecules. By introducing charged, hydrophobic, or hydrogen-bonding residues at strategic positions, researchers could develop MscL variants for selective transport applications.

  • Thermally tuned mechanosensors: Leveraging the thermostability of C. aurantiacus MscL to create sensors that function optimally at elevated temperatures would fill a niche for industrial biosensing applications in high-temperature environments where mesophilic proteins fail.

  • MscL-enzyme fusions: Creating chimeric proteins that couple MscL conformational changes with enzymatic activity could yield mechanically activated biocatalysts. These could serve as components in responsive bioreactors where enzymatic activity is triggered by defined mechanical stimuli.

The implementation of these engineering strategies would benefit from advances in computational protein design, high-throughput screening methodologies, and increasingly precise methods for applying and measuring membrane tension in reconstituted systems.

What unresolved questions remain in understanding the relationship between MscL structure, membrane properties, and channel function?

Despite significant advances in understanding MscL mechanosensation, several fundamental questions remain unresolved at the intersection of channel structure, membrane properties, and function:

  • Molecular details of force transmission: While we know that MscL responds to membrane tension, the precise molecular pathway by which forces are transmitted from the membrane to specific protein domains remains incompletely understood. Research has established that gating involves "hydrophobic mismatch and changes in the membrane curvature and/or transbilayer pressure profile" , but the relative contributions of these mechanisms and their molecular details require further investigation.

  • Asymmetric membrane effects: Most biophysical studies of MscL use symmetric bilayers, yet biological membranes are inherently asymmetric in both lipid composition and tension. How MscL responds to asymmetric membrane environments, particularly in the context of bacterial cell envelopes with complex architecture, remains poorly characterized.

  • Conformational trajectory during gating: While structures of closed and open states have been determined for some MscL homologs, the complete conformational trajectory and potential intermediate states during channel gating remain elusive. Studies have shown that "the channel protein forms a homopentamer with each subunit containing two transmembrane regions" , but how these subunits coordinately rearrange during gating requires further structural analysis.

  • Integration with other cellular mechanosensing systems: How MscL functions alongside other mechanosensitive channels (like MscS) and cell envelope components remains incompletely understood. Research in S. aureus has suggested differences in critical adhesion forces for MscL versus MscS activation , but the functional significance of these differences in coordinated cellular responses to mechanical stimuli warrants further investigation.

  • Species-specific adaptations: While the basic MscL architecture is conserved, the specific adaptations that optimize channel function for different bacterial lifestyles (thermophilic, psychrophilic, halophilic, etc.) remain largely unexplored. Understanding these adaptations would provide insights into both evolutionary mechanisms and principles for rational channel engineering.

Addressing these questions will require interdisciplinary approaches combining structural biology, molecular dynamics simulations, advanced spectroscopy, and novel methodologies for precisely manipulating and measuring membrane properties in increasingly native-like experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.