Recombinant Chloroflexus aurantiacus NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on your location and the chosen purchasing method. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. This can be used as a reference for your own formulations.
Shelf Life
Shelf life can vary depending on multiple factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development for your product.
Synonyms
nuoA; Caur_1987; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Target Names
nuoA
Target Protein Sequence
MLANYALIGIFLVAAISFPLIPLVLAFFLRPKRPTPLKTSTYECGLEAIGDVHVQFKVQY YLYALAFVIFDIEVIFLYPWAVAFNAVGLYGLIAATIFLLMLFAGLLYEWRKGALEWV
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transport from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is believed to be the enzyme's immediate electron acceptor. It couples the redox reaction with proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit A from Chloroflexus aurantiacus?

NADH-quinone oxidoreductase subunit A (nuoA) is a membrane protein component of the NADH dehydrogenase I complex in Chloroflexus aurantiacus, also known as NDH-1 subunit A or NUO1. It features an EC number of 1.6.99.5 and plays a critical role in electron transport chains within this thermophilic filamentous anoxygenic phototrophic bacterium. The protein contains 118 amino acids in its expression region and is predominantly hydrophobic with multiple transmembrane segments, consistent with its function in the membrane-embedded portion of the respiratory complex I .

What are the structural characteristics of Chloroflexus aurantiacus nuoA?

The amino acid sequence of Chloroflexus aurantiacus nuoA (UniProt: A9WEE0) is: mLANYALIGIFLVAAISFPLIPLVLAFFLRPKRPTPLKTSTYECGLEAIGDVHVQFKVQYYLYALAFVIFDIEVIFLYPWAVAFNAVGLYGLIAATIFLLmLFAGLLYEWRKGALEWV . Analysis of this sequence reveals multiple hydrophobic regions, consistent with its role as a membrane-spanning protein. The protein contains characteristic motifs found in other NADH-quinone oxidoreductase subunits, suggesting evolutionary conservation of function across species. This structural arrangement facilitates electron transfer within the respiratory complex, contributing to energy conservation during both aerobic and anaerobic growth of C. aurantiacus .

Why is Chloroflexus aurantiacus significant for research in microbial energy metabolism?

Chloroflexus aurantiacus represents a critical model organism for understanding the evolution of photosynthesis and bioenergetics. As a thermophilic filamentous anoxygenic phototrophic (FAP) bacterium, it occupies an evolutionary position that bridges anaerobic and aerobic metabolic strategies. The organism possesses a chimeric photosynthetic apparatus with components resembling both green sulfur bacteria and purple photosynthetic bacteria. Its genome contains duplicate genes for multiple respiratory components, including NADH:quinone oxidoreductase complexes, reflecting adaptations for growth under varying oxygen conditions . This metabolic flexibility makes C. aurantiacus an excellent subject for studying the evolution of electron transport chains and respiratory adaptations during Earth's transition from anaerobic to aerobic conditions.

What are the optimal storage conditions for recombinant nuoA protein?

For recombinant Chloroflexus aurantiacus NADH-quinone oxidoreductase subunit A (nuoA), optimal storage requires attention to protein stability and prevention of activity loss. Store the protein at -20°C for regular use, or at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein to maintain structural integrity and function . To minimize protein degradation, avoid repeated freeze-thaw cycles, as these can significantly compromise protein quality and enzymatic activity. When working with the protein, prepare small working aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw damage while maintaining experimental consistency .

How can researchers address contradictory results when studying nuoA function in different experimental systems?

When confronting contradictory results in nuoA functional studies, researchers should systematically evaluate experimental design variations that may account for these discrepancies. As highlighted in scientific literature on experimental design influence, seemingly minor methodological decisions can profoundly impact study outcomes . For nuoA specifically, consider the following reconciliation approach:

  • Control group selection: Different reference points may yield varying effect magnitudes. Document the specific strain backgrounds or control conditions employed.

  • Expression system compatibility: The expression host's native respiratory machinery may interact differently with heterologous nuoA components, creating system-specific artifacts.

  • Buffer and assay conditions: Minor variations in pH, salt concentration, or reducing conditions can dramatically alter membrane protein behavior.

  • Post-translational modifications: Verify biotinylation status or other modifications that might vary between expression systems.

  • Statistical analysis methods: Standardize quantification techniques and statistical approaches across comparative studies .

Rather than assuming one set of results is incorrect, recognize that both observations may be valid within their specific experimental contexts, with the variations providing valuable insights into nuoA's functional flexibility.

What methodological considerations are important when designing experiments to study nuoA in the context of C. aurantiacus respiratory adaptations?

When designing experiments to investigate nuoA's role in Chloroflexus aurantiacus respiratory adaptations, researchers must consider the organism's unique ability to thrive in both anaerobic photosynthetic and aerobic respiratory conditions. This experimental design should include:

  • Oxygen gradient controls: Establish precise oxygen tension conditions ranging from strictly anaerobic to fully aerobic environments, with particular attention to microaerobic transition states where respiratory chain remodeling may occur.

  • Comparative genomic approach: Leverage the presence of duplicate NADH:quinone oxidoreductase gene clusters in C. aurantiacus to examine differential expression and assembly under varying environmental conditions .

  • Temperature optimization: As a thermophile with temperature optimum between 52-60°C, ensure experimental conditions reflect the native thermal environment where protein-protein interactions and electron transfer kinetics are physiologically relevant .

  • Integration with photosynthetic apparatus: Design experiments that account for the interaction between respiratory complexes and photosynthetic electron transport, particularly when studying transition between growth modes.

  • Temporal resolution: Implement time-course experiments to capture dynamic changes in nuoA expression and complex assembly during environmental transitions.

This multifaceted approach acknowledges the complexity of C. aurantiacus respiratory adaptations and positions nuoA studies within their appropriate physiological context.

How does the structure-function relationship of nuoA contribute to the bioenergetic flexibility of Chloroflexus aurantiacus?

The structure-function relationship of nuoA plays a pivotal role in the remarkable bioenergetic flexibility of Chloroflexus aurantiacus. This membrane protein contributes to the organism's ability to thrive in both anaerobic photosynthetic and aerobic respiratory conditions through several mechanisms:

  • Membrane anchoring: The highly hydrophobic composition of nuoA (LANYALIGIF LVAAISFPLI PLVLAFFLRP KRPTPLKTST YECGLEAIGD VHVQFKVQYY LYALAFVIFD IEVIFLYPWA VAFNAVGLYG LIAATIFLLL MFAGLLYEWR KGALEWV) provides critical membrane anchoring for the NDH-1 complex .

  • Quinone interaction sites: Structural analyses suggest nuoA contributes to forming the quinone-binding pocket, facilitating electron transfer to various terminal electron acceptors depending on environmental conditions.

  • Complex assembly coordination: nuoA likely serves as a nucleation point for the assembly of other subunits into the functional respiratory complex.

  • Oxygen sensing integration: The presence of duplicate NADH:quinone oxidoreductase genes in C. aurantiacus suggests specialized roles for different complex assemblies under varying oxygen tensions .

  • Thermostability contribution: As part of a thermophilic organism's respiratory machinery, nuoA's structural features contribute to the thermal stability of the entire complex at the organism's growth temperature optimum of 52-60°C .

This structural versatility enables C. aurantiacus to efficiently redirect electron flow in response to changing environmental conditions, representing an evolutionary adaptation that likely contributed to the organism's success during Earth's transition to an oxygen-rich atmosphere.

What methodological approaches can be used to study the interaction between nuoA and other components of the respiratory chain in C. aurantiacus?

Investigating nuoA interactions with other respiratory chain components requires sophisticated methodological approaches tailored to membrane protein complexes. Researchers should consider implementing:

  • Blue native PAGE coupled with mass spectrometry: This technique preserves native protein-protein interactions while separating intact respiratory complexes, followed by identification of interacting partners through proteomics.

  • Chemical cross-linking followed by pulldown assays: Using the recombinant nuoA protein with appropriate tags, researchers can perform crosslinking experiments to capture transient interactions within the respiratory chain .

  • FRET-based interaction analysis: Fluorescently labeled nuoA can be used to detect proximity to other respiratory components through Förster resonance energy transfer measurements.

  • Complementation studies: Genetic systems employing nuoA variants can test functional complementation in heterologous systems or mutant strains.

  • Cryo-electron microscopy: For structural determination of nuoA within the context of the entire respiratory complex, allowing visualization of interaction interfaces.

  • Comparative analyses with related organisms: Leveraging genomic and biochemical data from closely related species like Roseiflexus castenholzii can provide evolutionary context for nuoA interactions .

These methodological approaches should be conducted under conditions that mirror the thermophilic nature of C. aurantiacus (optimum 52-60°C) to maintain physiologically relevant protein conformations and interactions .

How can researchers investigate nuoA's role in the evolutionary adaptation of C. aurantiacus to varying oxygen conditions?

To investigate nuoA's evolutionary role in C. aurantiacus adaptation to varying oxygen conditions, researchers should employ a multidisciplinary approach that integrates genomic, biochemical, and physiological analyses:

  • Comparative genomics framework: Analyze nuoA sequence conservation across the Chloroflexi phylum, with special attention to species inhabiting different oxygen niches. This should include comparison with related organisms like Roseiflexus castenholzii to identify conserved versus divergent features .

  • Expression profiling under oxygen gradients: Implement RNA-seq or quantitative proteomics to track differential expression of nuoA and related genes across precisely controlled oxygen concentrations.

  • Ancestral sequence reconstruction: Computationally predict ancestral nuoA sequences to recreate and functionally characterize evolutionary intermediates.

  • Site-directed mutagenesis experiments: Target conserved residues within nuoA to assess their contribution to function under aerobic versus anaerobic conditions.

  • Metabolic flux analysis: Combine isotope labeling with metabolomics to quantify how nuoA variants affect electron flow through respiratory versus photosynthetic pathways.

This approach acknowledges C. aurantiacus's importance as a model organism for understanding the evolution of metabolic strategies during Earth's transition from anaerobic to aerobic conditions, with nuoA playing a key role in this adaptation through its participation in the respiratory electron transport chain .

What are the common challenges in working with recombinant membrane proteins like nuoA, and how can they be addressed?

Working with recombinant membrane proteins such as nuoA presents several technical challenges that require specialized approaches:

  • Expression yield limitations: Membrane proteins often express poorly in heterologous systems. Optimize expression by:

    • Testing multiple expression hosts and vectors

    • Employing specialized strains designed for membrane protein expression

    • Using fusion tags that enhance solubility

    • Implementing controlled induction protocols with reduced temperature during expression

  • Protein misfolding: The complex topology of nuoA can lead to misfolding. Address this by:

    • Including appropriate chaperones during expression

    • Using mild detergents that maintain native-like membrane environments

    • Expressing in membrane-mimetic systems like nanodiscs or liposomes

  • Purification interference: The highly hydrophobic nature of nuoA complicates purification. Improve results by:

    • Optimizing detergent selection for solubilization

    • Implementing two-phase purification strategies

    • Using specialized chromatography resins designed for membrane proteins

  • Activity assessment challenges: Standard activity assays may be compromised by detergents. Develop:

    • Reconstitution protocols in proteoliposomes

    • Activity assays compatible with detergent presence

    • Indirect measurements of protein function

  • Storage stability issues: Recombinant nuoA requires specialized storage conditions:

    • Maintain in Tris-based buffer with 50% glycerol

    • Store at -20°C or -80°C for extended periods

    • Avoid repeated freeze-thaw cycles

    • Prepare working aliquots for short-term use at 4°C

Addressing these challenges requires patience and systematic optimization of conditions specific to the unique properties of nuoA.

How can researchers distinguish between contradictory results in nuoA studies that arise from experimental design versus genuine biological variation?

Distinguishing between contradictory nuoA results stemming from experimental design versus biological variation requires a systematic investigative approach:

Source of VariationDiagnostic IndicatorsResolution Strategy
Experimental DesignResults differ when using identical biological materials but different protocolsStandardize critical protocol elements; document all methodological decisions
Biological VariationResults differ even with standardized protocols across different strain backgroundsCharacterize specific genetic or physiological differences between strains
Statistical ArtifactContradictions disappear with increased sample size or different analysis methodsImplement more robust statistical approaches; increase replication
Environmental FactorsResults vary with subtle differences in growth conditionsSystematically test environmental variables; standardize growth parameters
Technical VariationResults fluctuate between experimental runs without clear patternImplement internal controls; develop standardized reference materials

When evaluating contradictory findings, researchers should recognize that experimental design decisions—including control group selection, assay conditions, and data analysis approaches—can significantly influence outcomes without invalidating either result . The solution often involves implementing controlled variation studies where single variables are systematically altered to identify specific factors driving result discrepancies. This approach transforms apparent contradictions into valuable insights about nuoA's context-dependent behavior.

What statistical approaches are most appropriate for analyzing nuoA functional data across different experimental conditions?

When analyzing functional data for nuoA across varying experimental conditions, researchers should employ statistical approaches that account for the complex, multilevel nature of bioenergetic experiments:

  • Mixed-effects modeling: Ideal for experimental designs where measurements are nested within biological replicates and experimental conditions. This approach can:

    • Account for random effects from biological variation

    • Incorporate fixed effects from experimental treatments

    • Handle unbalanced designs common in complex membrane protein studies

    • Appropriately model repeated measures across oxygen concentrations or time points

  • Multivariate analysis for respiratory chain interactions:

    • Principal Component Analysis (PCA) to identify patterns in nuoA interaction data

    • Partial Least Squares Discriminant Analysis (PLS-DA) to correlate protein interactions with functional outcomes

    • Network analysis to visualize complex respiratory chain component interactions

  • Bayesian approaches for integrating prior knowledge:

    • Incorporate evolutionary information about conserved nuoA functions

    • Update models with new experimental evidence

    • Estimate uncertainty in complex bioenergetic models

  • Robust statistics for handling outliers:

    • Non-parametric methods when normality assumptions are violated

    • Bootstrapping to establish confidence intervals without assuming specific distributions

    • Permutation tests to establish significance in complex experimental designs

  • Meta-analytical framework for reconciling contradictory results:

    • Formal techniques to integrate data across multiple studies

    • Assessment of heterogeneity in experimental approaches

    • Identification of moderator variables that explain divergent outcomes

Researchers should recognize that contradictory results often emerge from subtle experimental design decisions rather than flawed methodology, highlighting the need for comprehensive statistical approaches that embrace rather than obscure experimental complexity .

How might nuoA be utilized in synthetic biology applications related to bioenergy production?

The nuoA protein from Chloroflexus aurantiacus offers several promising applications in synthetic biology approaches to bioenergy production:

  • Thermostable electron transport engineering: As a component from a thermophilic organism (temperature optimum 52-60°C), nuoA could be incorporated into synthetic electron transport chains designed to function at elevated temperatures, potentially improving reaction kinetics and reducing cooling costs in bioenergy applications .

  • Oxygen-adaptive bioenergy systems: Leveraging C. aurantiacus's ability to function under varying oxygen conditions, engineered systems incorporating nuoA could adapt to fluctuating oxygen levels in bioreactors, maintaining efficient energy conversion regardless of environmental conditions .

  • Photosynthetic-respiratory hybrid systems: The natural context of nuoA in an organism with both photosynthetic and respiratory capabilities suggests applications in synthetic systems that harvest light energy while maintaining respiratory flexibility.

  • Carbon fixation coupling: C. aurantiacus utilizes the 3-hydroxypropionate bi-cycle for carbon fixation, which could be coupled with engineered respiratory chains containing nuoA to create systems that simultaneously fix carbon and generate bioenergy products .

  • Modular respiratory complex design: The understanding of nuoA structure and function could enable the design of modular respiratory complexes with tailored electron transport properties for specific bioenergy applications.

These applications would require thorough characterization of nuoA's structure-function relationships, adaptation to heterologous expression systems, and integration with other components to create functional synthetic bioenergy systems.

What research gaps remain in understanding the evolutionary significance of nuoA in the transition from anaerobic to aerobic metabolism?

Despite significant advances, several critical research gaps remain in understanding nuoA's evolutionary significance during metabolic transitions:

  • Ancestral state reconstruction: While genomic evidence suggests C. aurantiacus possesses adaptations for both anaerobic and aerobic growth, including duplicate genes for respiratory complexes like NADH:quinone oxidoreductase , the ancestral state of nuoA and its evolutionary trajectory remain unclear.

  • Functional intermediates: The evolutionary steps between strictly anaerobic and facultatively aerobic respiratory complexes containing nuoA have not been fully characterized, leaving questions about the intermediate functional states during this transition.

  • Horizontal gene transfer assessment: The potential role of horizontal gene transfer in shaping nuoA evolution across the Chloroflexi phylum requires more comprehensive phylogenomic analysis.

  • Oxygen sensing integration: How nuoA and its associated respiratory complexes became integrated with oxygen sensing mechanisms during evolution remains poorly understood.

  • Co-evolution with photosynthesis: The relationship between nuoA evolution and the development of the chimeric photosynthetic apparatus in C. aurantiacus presents an unresolved question about the coordination of these two energy-generating systems .

  • Functional redundancy resolution: The evolutionary pressures that maintained duplicate copies of respiratory complex genes, including those encoding nuoA, and their potential subfunctionalization represent a significant knowledge gap .

Addressing these gaps would provide crucial insights into one of the most significant metabolic transitions in Earth's history: the adaptation of life to increasing atmospheric oxygen levels.

How can structural biology approaches enhance our understanding of nuoA function within the respiratory complex?

Advanced structural biology approaches offer transformative potential for elucidating nuoA function within the respiratory complex:

  • Cryo-electron microscopy (cryo-EM): This technique can reveal:

    • The precise positioning of nuoA within the larger respiratory complex

    • Conformational changes associated with electron transfer

    • Interaction interfaces with other subunits

    • Potential oxygen-sensing regions within the complex

  • Integrative structural biology combining multiple techniques:

    • X-ray crystallography for high-resolution details of specific domains

    • Small-angle X-ray scattering (SAXS) for solution structure information

    • Nuclear magnetic resonance (NMR) for dynamic regions analysis

    • Mass spectrometry for subunit stoichiometry and post-translational modifications

  • Molecular dynamics simulations:

    • Modeling of nuoA behavior within a membrane environment

    • Prediction of conformational changes during electron transfer

    • Identification of critical residues for protein-protein interactions

    • Analysis of thermostability mechanisms relevant to C. aurantiacus growth temperature (52-60°C)

  • In situ structural approaches:

    • Cellular tomography to visualize respiratory complexes in their native membrane environment

    • Correlative light and electron microscopy to connect structure with function

    • Single-particle tracking to analyze dynamics within membranes

  • Time-resolved structural methods:

    • Serial femtosecond crystallography to capture transitional states

    • Time-resolved cryo-EM to visualize dynamic processes

These approaches would provide unprecedented insights into how nuoA contributes to respiratory function in C. aurantiacus, particularly regarding its role in facilitating growth under both anaerobic and aerobic conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.