Recombinant Chloroflexus aurantiacus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Chloroflexus aurantiacus NADH-quinone oxidoreductase subunit K (nuoK) is a purified, recombinant protein derived from the thermophilic, filamentous anoxygenic phototroph C. aurantiacus. It serves as a critical component of NADH dehydrogenase I (NDH-1), the primary NADH:quinone oxidoreductase complex in bacterial respiratory chains . This enzyme facilitates electron transfer from NADH to quinones, contributing to proton gradient formation and ATP synthesis .

Amino Acid Sequence and Expression

  • Full-length sequence: MVPTSYYVLLSAILFTIGVLGVLLRRNAIVVFMAVELMLNAANLALVAFARERLGVEAQVIVFFVITVAAAEVAVGLALLVSIFRTKRTADVDEVSTLKG .

  • Length: 100 amino acids (1–100aa) .

  • Expression system: E. coli with an N-terminal His-tag for affinity purification .

Functional Role in Bacterial Respiration

NuoK is one of ~14 subunits in the NDH-1 complex, which catalyzes the oxidation of NADH to quinones while translocating protons across the membrane . This activity is critical for:

  • Energy transduction: Coupling electron transfer to proton pumping, a hallmark of aerobic respiration .

  • Metabolic flexibility: C. aurantiacus utilizes NDH-1 in both phototrophic (anoxic) and chemoorganotrophic (oxic) conditions, as evidenced by genomic and proteomic studies .

Production and Characterization

  • Purification: His-tagged protein is isolated via nickel affinity chromatography, yielding >90% purity .

  • Stability: Lyophilized powder stored at -20°C/-80°C; repeated freeze-thaw cycles are discouraged .

Comparative Genomic and Proteomic Insights

  • Genomic context: C. aurantiacus possesses duplicated NDH-1 gene clusters (Caur_2896–2909 and Caur_1976–1987), enabling adaptation to varying redox states .

  • Proteomic studies: Under photoheterotrophic growth, NDH-1 subunits like nuoK are upregulated, highlighting their role in light-driven electron transport .

Evolutionary and Bioenergetic Significance

  • Unique features: C. aurantiacus NDH-1 lacks Na+/H+ antiport activity, unlike homologs in Rhodothermus marinus or E. coli, suggesting distinct coupling mechanisms .

  • Thermophilic adaptation: The recombinant protein’s thermostability aligns with C. aurantiacus’ optimal growth at 52–60°C .

Table 1: Recombinant nuoK Product Variants

Cat. No.UniProt IDAA SequenceSource
RFL14356CFB9LAV0Full-length (1–100aa) E. coli
RFL2481CFA9WFC1Full-length (1–100aa) E. coli

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
nuoK; Caur_2906; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Target Names
nuoK
Target Protein Sequence
MVPTSYYVLLSAILFTIGVLGVLLRRNAIVVFMAVELMLNAANLALVAFARERLGVEAQV IVFFVITVAAAEVAVGLALLVSIFRTKRTADVDEVSTLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for this enzyme is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Biological Classification and Habitat

Chloroflexus aurantiacus J-10-fl belongs to the bacterial phylum Chloroflexi, class Chloroflexi, order Chloroflexales, family Chloroflexaceae. It is a thermophilic organism isolated from the Hakone hot spring area in Japan, with optimal growth temperatures between 52-60°C in freshwater hot spring environments. The bacterium forms filamentous structures, is mobile, gram-negative, and classified as a green non-sulfur bacterium capable of anaerobic growth .

Genome and Respiratory Complexes

The genome of Chloroflexus aurantiacus J-10-fl is approximately 5.3-Mb in size, comparable to other phototrophic Chloroflexi species. A distinctive feature of C. aurantiacus is its possession of two gene clusters encoding NADH:quinone oxidoreductase (Complex I, EC 1.6.5.3), including nuoK (Caur_1980), which plays a critical role in the organism's electron transport chain. Additionally, C. aurantiacus utilizes an unusual electron transfer complex called Alternative Complex III (ACIII) instead of the cytochrome bc or bf complexes found in most phototrophs .

What is the function of NADH-quinone oxidoreductase subunit K in Chloroflexus aurantiacus?

The nuoK subunit (Caur_1980) in Chloroflexus aurantiacus is an integral component of NADH:quinone oxidoreductase (Complex I), which catalyzes the transfer of electrons from NADH to quinones in the respiratory chain. NuoK is one of the membrane-embedded subunits of Complex I and contributes to proton translocation across the membrane, thereby helping to establish the proton motive force used for ATP synthesis. In C. aurantiacus, this process is particularly important during anaerobic photosynthetic growth when the bacterium must efficiently manage electron flow through its unique photosynthetic apparatus .

What expression systems are recommended for recombinant production of Chloroflexus aurantiacus nuoK?

For recombinant expression of C. aurantiacus nuoK, E. coli-based expression systems have been successfully employed for related proteins from thermophilic organisms. When expressing thermostable proteins like nuoK, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) are recommended due to the membrane-integral nature of nuoK. Expression vectors containing T7 promoters (pET series) or trc promoters (pTRC series) with appropriate temperature-inducible or IPTG-inducible regulation have shown efficacy. For optimal expression, careful temperature control during induction (typically 25-30°C) helps prevent inclusion body formation while maintaining protein stability .

What is the relationship between nuoK and the Alternative Complex III in the electron transport chain of Chloroflexus aurantiacus?

In C. aurantiacus, nuoK (as part of Complex I) and the Alternative Complex III (ACIII) operate in a coordinated manner within the electron transport chain. Complex I (containing nuoK) oxidizes NADH and reduces quinones, while ACIII functions as a menaquinol:auracyanin oxidoreductase. The electron flow proceeds from Complex I through the quinone pool to ACIII and then to the reaction center. This arrangement differs from the conventional electron transport chains found in most phototrophs that utilize cytochrome bc1 or b6f complexes instead of ACIII. The spatial organization and potential protein-protein interactions between Complex I components (including nuoK) and ACIII components (particularly ActE, the terminal electron carrier of ACIII) may facilitate efficient electron transfer in this unique arrangement. This specialized electron transport architecture likely evolved to optimize energy conservation under the thermophilic, anaerobic, photosynthetic lifestyle of C. aurantiacus .

What techniques are most effective for assessing the functional integrity of recombinant nuoK?

Several complementary techniques are essential for comprehensive assessment of recombinant nuoK functionality:

  • Membrane Protein Reconstitution: Reconstituting purified recombinant nuoK into liposomes containing other Complex I subunits provides a system for functional assessment. This approach allows evaluation of proper membrane insertion and interactions with partner subunits.

  • Proton Translocation Assays: Using pH-sensitive fluorescent probes (such as ACMA or pyranine) in proteoliposomes containing reconstituted Complex I with recombinant nuoK to monitor proton pumping activity upon NADH addition.

  • Site-Directed Mutagenesis and Activity Correlation: Systematic mutation of conserved residues in nuoK followed by activity measurements to identify functionally critical amino acids.

  • Thermal Stability Assessment: Differential scanning calorimetry (DSC) or thermal shift assays to evaluate the thermostability of the reconstituted complex containing recombinant nuoK, particularly important given the thermophilic nature of C. aurantiacus.

  • Cross-linking Studies: Chemical cross-linking coupled with mass spectrometry to verify correct interactions between nuoK and neighboring subunits in the assembled complex .

Expression Optimization Table:

ParameterRecommended ConditionsRationale
Host strainC41(DE3) or C43(DE3)Enhanced tolerance for membrane protein overexpression
Growth temperature30°C pre-induction, 25°C post-inductionBalances growth rate with proper protein folding
Induction0.1-0.5 mM IPTG at OD600 of 0.6-0.8Moderate induction prevents toxic accumulation
Media supplements5-10 μM FeCl3, trace elementsSupports cofactor incorporation
Expression duration6-8 hours or overnight at reduced temperatureAllows sufficient time for proper membrane insertion

Purification Protocol:

  • Membrane Isolation: Cells are disrupted by sonication or French press, followed by differential centrifugation to isolate membrane fractions.

  • Solubilization: Membranes are solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at 1-2% (w/v) with gentle agitation for 1-2 hours at 4°C.

  • Affinity Chromatography: If recombinant nuoK contains an affinity tag (His6 or Strep-tag II), immobilized metal affinity chromatography (IMAC) or Strep-Tactin chromatography is employed with detergent-containing buffers.

  • Size Exclusion Chromatography: Further purification by size exclusion chromatography in buffers containing 0.05-0.1% detergent removes aggregates and ensures homogeneity.

  • Detergent Exchange: If needed for downstream applications, the protein can be exchanged into different detergents or reconstituted into nanodiscs or liposomes .

What spectroscopic techniques are most informative for studying electron transfer involving nuoK-containing complexes?

Multiple spectroscopic approaches provide complementary information about electron transfer involving nuoK-containing complexes:

  • UV-Visible Spectroscopy: Monitors redox state changes of electron carriers (flavins, iron-sulfur clusters) during electron transfer. Time-resolved measurements can track electron flow kinetics through the complex.

  • EPR Spectroscopy: Critical for characterizing paramagnetic centers such as iron-sulfur clusters in Complex I. Continuous wave EPR at various temperatures (10-100K) can distinguish different Fe-S clusters, while pulse EPR techniques provide information about the local environment of these centers.

  • FTIR Difference Spectroscopy: Detects conformational changes and protonation/deprotonation events coupled to electron transfer, offering insights into the mechanism of proton pumping involving nuoK.

  • Resonance Raman Spectroscopy: Provides vibrational information about cofactors and can track subtle structural changes during electron transfer.

  • Fluorescence Spectroscopy: Using pH-sensitive fluorophores to monitor proton translocation events coupled to electron transfer through nuoK-containing complexes.

For Complex I containing recombinant nuoK from C. aurantiacus, these techniques must be adapted for thermostable complexes, often requiring modified sample handling and temperature control during measurements .

How should researchers interpret conflicting kinetic data from recombinant versus native nuoK-containing complexes?

When faced with discrepancies between kinetic parameters of recombinant versus native nuoK-containing complexes, researchers should consider multiple factors:

  • Post-translational Modifications: Native nuoK may undergo modifications absent in recombinant systems. Mass spectrometry analysis of both native and recombinant proteins can identify missing modifications.

  • Lipid Environment Effects: The native membrane lipid composition of C. aurantiacus (adapted to thermophilic conditions) differs significantly from E. coli or other expression hosts. Reconstitution experiments using different lipid compositions can help determine whether lipid interactions impact kinetic parameters.

  • Subunit Stoichiometry and Assembly: Confirm that recombinant complexes maintain the correct stoichiometry and complete assembly using analytical ultracentrifugation or blue native PAGE.

  • Temperature-Dependent Kinetics: Given C. aurantiacus's thermophilic nature, kinetic measurements should be performed across a range of temperatures (25-60°C) for both native and recombinant complexes to establish comparable activity profiles.

  • Electron Donor/Acceptor Affinities: Differences in kinetic parameters may reflect altered affinities for electron donors (NADH) or acceptors (quinones) rather than intrinsic protein function. Determining Km values for these substrates can clarify the source of discrepancies .

What evolutionary insights can be gained from comparing nuoK sequences across Chloroflexus species?

Comparative analysis of nuoK sequences across Chloroflexus species reveals important evolutionary adaptations:

  • Thermal Adaptation Signatures: Thermophilic Chloroflexus strains show characteristic amino acid substitutions in nuoK that enhance thermostability, including increased proportions of charged residues forming salt bridges and hydrophobic core residues that strengthen hydrophobic interactions.

  • Niche-Specific Adaptations: Chloroflexus strains from different thermal environments (like those studied at White Creek, Yellowstone National Park) show nuoK sequence variations that correlate with their optimal growth temperatures, reflecting adaptation to specific thermal niches.

  • Conserved Functional Domains: Despite sequence variations, regions directly involved in proton translocation remain highly conserved across all Chloroflexus species, highlighting their essential functional role.

  • Co-evolution with Partner Subunits: Mutations in nuoK often co-evolve with complementary changes in interacting subunits, maintaining critical structural interfaces within Complex I.

  • Horizontal Gene Transfer Assessment: Comparing synonymous vs. non-synonymous substitution rates in nuoK across Chloroflexus species can reveal instances of horizontal gene transfer versus vertical inheritance of respiratory complex genes .

What are the most promising applications of engineered Chloroflexus aurantiacus nuoK variants?

Several promising research avenues exist for engineered C. aurantiacus nuoK variants:

  • Thermostable Bioenergetic Systems: Engineered nuoK variants with enhanced thermostability could be incorporated into synthetic bioenergetic systems for biotechnological applications requiring operation at elevated temperatures.

  • Proton Pumping Efficiency: Variants with modified proton translocation pathways may achieve altered H+/e- ratios, potentially enabling the design of more efficient bioenergetic systems.

  • Model Systems for Complex I Research: Given the relative simplicity of bacterial Complex I compared to mitochondrial counterparts, engineered C. aurantiacus nuoK variants could serve as valuable model systems for understanding fundamental aspects of Complex I function in a thermophilic context.

  • Structural Studies Facilitation: Thermostable nuoK variants with enhanced crystallizability could facilitate structural studies of membrane protein complexes, addressing a persistent challenge in structural biology.

  • Biohydrogen Production: Engineered nuoK variants with altered electron transfer properties could potentially be incorporated into systems designed for biohydrogen production at elevated temperatures .

How might CRISPR-Cas9 genome editing be optimized for studying nuoK function in native Chloroflexus aurantiacus?

Implementing CRISPR-Cas9 genome editing in C. aurantiacus requires specialized approaches:

  • Thermostable CRISPR Components: Standard S. pyogenes Cas9 has limited activity at C. aurantiacus growth temperatures (52-60°C). Alternative CRISPR systems from thermophiles such as Geobacillus stearothermophilus or engineered thermostable Cas9 variants should be employed.

  • Delivery Methods: Electroporation protocols must be optimized for C. aurantiacus, accounting for its filamentous structure and unusual cell wall composition. Alternatively, conjugation from E. coli donor strains using broad-host-range plasmids may prove more effective.

  • Guide RNA Design: Guide RNAs targeting nuoK should be designed accounting for the high GC content typical of Chloroflexus genomes, and should avoid regions with secondary structure that might impair Cas9 function at elevated temperatures.

  • Homology-Directed Repair Templates: Homology arms of 1-2 kb flanking the nuoK modification site enhance repair efficiency. These templates must be designed with codon usage appropriate for C. aurantiacus.

  • Selection Strategies: Given the limited genetic tools available for Chloroflexus, counterselection strategies using markers like sacB (conferring sucrose sensitivity) combined with positive selection markers compatible with thermophilic growth conditions represent the most promising approach .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.