Recombinant Chloroflexus aurantiacus Reaction center protein L chain (pufL)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Molecular Properties

PropertyDetails
Source OrganismChloroflexus aurantiacus (strain J-10-fl)
Expression HostE. coli
Protein Length310 amino acids (Full-length mature protein)
TagN-terminal His-tag
Molecular Weight~35 kDa (calculated)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Role in Photosynthesis

The pufL protein is integral to the RC’s electron transport chain:

  • Electron Transfer: Works with pufM to facilitate light-driven charge separation, transferring electrons to menaquinone .

  • Light-Harvesting Integration: Receives excitons from the B808-866 core antenna complex, enabling energy conversion .

  • Aerobic Adaptation: Unlike purple bacteria, C. aurantiacus expresses pufL under aerobic light conditions, suggesting dual metabolic versatility .

3.2. Biotechnological Relevance

  • Photosystem Engineering: Serves as a template for synthetic RC designs in bioenergy applications .

  • Evolutionary Insights: Homologs in novel Chloroflexi lineages (e.g., Anaerolineae) highlight ancient phototrophic adaptations .

Expression and Purification

Recombinant pufL is produced under optimized conditions:

  • Expression System: E. coli with codon-optimized vectors .

  • Purification: Affinity chromatography via His-tag, followed by gel filtration .

  • Yield: ~0.1–1.0 mg/mL after reconstitution in sterile water or glycerol .

Table 2: Expression and Purification Overview

ParameterDetails
Host StrainE. coli BL21(DE3) or equivalent
InductionIPTG (0.1–1.0 mM)
SolubilityMembrane-associated; requires detergents for extraction
BufferTris/PBS with 50% glycerol (pH 8.0)
StabilityStable at -80°C; avoid freeze-thaw cycles

Key Research Findings

  • Light-Dependent Regulation: Transcription of pufL increases 10-fold under aerobic light vs. dark conditions, linking photoheterotrophy to ATP synthesis .

  • Proteomic Identification: pufL is a biomarker in C. aurantiacus proteomes, upregulated in phototrophic growth .

  • Structural Divergence: Leu replaces His in bacteriochlorophyll-binding sites, altering RC spectroscopy vs. purple bacteria .

Future Directions

  • Cryo-EM Studies: High-resolution structural analysis of pufL/M complexes .

  • Metabolic Engineering: Optimizing pufL expression for artificial photosynthesis systems .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipment, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
pufL; Caur_1052; Reaction center protein L chain; Photosynthetic reaction center L subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-311
Protein Length
Full Length of Mature Protein
Species
Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Target Names
pufL
Target Protein Sequence
SRAKAKDPRFPDFSFTVVEGARATRVPGGRTIEEIEPEYKIKGRTTFSAIFRYDPFDFWV GPFYVGFWGFVSVIGIIFGSYFYINETILKGPYSIPQNFFAGRIDPPPPELGLGFAAPGE PGFAWQMTVLFATIAFFGWMMRQVDISMKLDMGYHVPIAFGVAFSAWLVLQVIRPIALGM WHEGFVLGIMPHLDWVSNFGYRYNNFFYNPFHAIGITGLFASTWLLACHGSLILSAAQYR GPEGGDIENVFFRDVQYYSVGESGVHRLGYIFAIGGILSADLCILLSGWPVQDWVSFWNF WNNLPFWSGV
Uniprot No.

Target Background

Function
The reaction center is a membrane-bound complex that mediates the initial photochemical event in the electron transfer process of photosynthesis.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Chloroflexus aurantiacus and why is it significant in photosynthesis research?

Chloroflexus aurantiacus is a thermophilic filamentous anoxygenic phototrophic (FAP) bacterium that occupies a unique evolutionary position in photosynthetic organisms. It can grow phototrophically under anaerobic conditions or chemotrophically under aerobic and dark conditions . According to 16S rRNA analysis, Chloroflexi species represent the earliest branching bacteria capable of photosynthesis, making C. aurantiacus a key organism for understanding the origin and early evolution of photosynthesis . Its significance lies in its chimeric photosystem that combines characteristics of both green sulfur bacteria and purple photosynthetic bacteria, providing valuable insights into photosynthetic evolution . The organism also possesses unique electron transport proteins compared to other photosynthetic bacteria, making it an important model for studying diverse photosynthetic mechanisms .

What is the function of the reaction center protein L chain (pufL) in photosynthesis?

The reaction center protein L chain (pufL) is a core structural component of the photosynthetic reaction center in Chloroflexus aurantiacus. It functions as part of the photosynthetic reaction center that facilitates light-induced electron transfer, a fundamental process in photosynthesis . In the photosystem, pufL works together with pufM (another reaction center protein) to form the functional reaction center complex . This complex is essential for capturing light energy that has been transferred from the chlorosome (a light-harvesting antenna) via the B808-866 light-harvesting core antenna complex . The pufL protein specifically binds pigment molecules like bacteriochlorophyll, enabling photoelectron generation when exposed to light . This protein-pigment interaction is crucial for the conversion of light energy into chemical energy during photosynthesis .

How is the pufL gene organized in the Chloroflexus aurantiacus genome?

In the Chloroflexus aurantiacus genome, the pufL gene is designated as Caur_1052 . It is located in proximity to the pufM gene (Caur_1051), which encodes the M subunit of the photosynthetic reaction center . This genomic organization is significant because it differs from the arrangement found in purple bacteria, where the puf (photosynthetic unit fixed) operon invariably contains the light-harvesting complex genes, the reaction center genes encoding for the L and M subunits, and the tetraheme cytochrome associated with the reaction center (if present) . Interestingly, in a related organism, Roseiflexus castenholzii, the pufL and pufM genes are fused, creating a single gene that encodes both subunits . This genomic variation provides insights into the evolutionary relationships and adaptations among photosynthetic bacteria.

What are the optimal conditions for expressing recombinant pufL protein in E. coli?

Recombinant expression of Chloroflexus aurantiacus pufL protein in E. coli requires careful optimization due to its membrane protein nature. Based on successful expression protocols, the full-length mature protein (amino acids 2-311) can be expressed with an N-terminal His-tag in E. coli expression systems . For optimal expression, researchers should consider using specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3). Expression should be induced at lower temperatures (16-20°C) after the culture reaches mid-log phase (OD600 of 0.6-0.8) to minimize inclusion body formation . The induction period should be extended (16-24 hours) with reduced inducer concentration to promote proper folding. Supplementation with specific cofactors may enhance proper folding and stability of the expressed protein. The expression media should be enriched with appropriate antibiotics for selection pressure to maintain the expression vector . After expression, the protein can be purified using affinity chromatography utilizing the His-tag, followed by additional purification steps if needed .

What techniques are recommended for purification and storage of recombinant pufL protein?

Purification of recombinant pufL protein requires specialized techniques due to its hydrophobic nature as a membrane protein. Initially, the bacterial cells should be disrupted using gentle methods such as enzymatic lysis or mild sonication to preserve protein structure. Membrane fractions containing the recombinant pufL can be isolated through differential centrifugation. For solubilization, mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin are recommended to maintain protein integrity . The solubilized protein can be purified using immobilized metal affinity chromatography (IMAC) targeting the His-tag, followed by size exclusion chromatography to enhance purity .

For storage, the purified protein should be maintained in a buffer containing Tris/PBS (pH 8.0) with 6% trehalose as a stabilizing agent . Aliquoting the protein solution is crucial to avoid repeated freeze-thaw cycles that can cause protein denaturation. The aliquots should be flash-frozen in liquid nitrogen and stored at -20°C or -80°C for long-term preservation . For enhanced stability during storage, addition of glycerol to a final concentration of 50% is recommended . Prior to use, the vials should be briefly centrifuged to bring contents to the bottom, and the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

How can the functionality of recombinant pufL be assessed in experimental systems?

Assessing the functionality of recombinant pufL requires multiple approaches to verify both structural integrity and functional activity. Structural integrity can be evaluated through circular dichroism (CD) spectroscopy to confirm proper secondary structure formation and thermal stability analysis to assess protein folding quality. SDS-PAGE analysis can verify protein purity and apparent molecular weight . Western blotting using antibodies specific to the His-tag or to pufL epitopes can confirm protein identity .

For functional assessment, researchers should examine the protein's ability to bind pigment molecules like magnesium protoporphyrin IX (MgP), which is an analog of bacteriochlorophyll a . This can be measured through absorption spectroscopy to detect characteristic spectral shifts upon pigment binding. Reconstitution experiments, where purified pufL is incorporated into liposomes or nanodiscs along with its partner proteins, can demonstrate its ability to assemble into functional complexes . Light-induced electron transfer activity can be measured using artificial electron donors and acceptors in reconstituted systems. Additionally, the protein's functionality in vivo can be assessed by complementation studies in photosynthetically deficient bacterial strains or through construction of chimeric photosystems in heterologous hosts like E. coli .

How can recombinant pufL be utilized in synthetic photosystems?

Recombinant pufL protein has significant potential in constructing synthetic photosystems for biotechnological applications. A groundbreaking approach involves designing biogenic photosystems such as NPM* by assembling backbone protein complexes that incorporate pufL . In this system, pufL serves as a core protein that can bind magnesium protoporphyrin IX (MgP), an analog of bacteriochlorophyll a, facilitating photoelectron generation . The system can be anchored to the inner membrane of bacterial cells using membrane proteins like NuoK*, which acts as an anchor protein . This engineered system enables the conversion of light energy into ATP and NADH through light reactions in heterologous hosts like E. coli .

For functional synthetic photosystems, pufL can be combined with other components to create biomimetic reaction centers. These synthetic systems can utilize methanol as an electron donor, providing a renewable source for electron transfer in the photosynthetic process . The successful integration of light and dark reactions in these systems can potentially enable the synthesis of bioproducts from one-carbon substrates like CO2 . This approach represents a significant advancement in sustainable biotechnology, where engineered photosynthetic systems can convert light energy into chemical energy for the production of valuable compounds through carbon fixation pathways .

What structural and functional comparisons exist between pufL from different photosynthetic bacteria?

The pufL protein from Chloroflexus aurantiacus shows interesting structural and functional variations when compared to analogous proteins in other photosynthetic bacteria. In terms of genomic organization, C. aurantiacus has separate pufL (Caur_1052) and pufM (Caur_1051) genes, whereas in Roseiflexus castenholzii, these genes are fused into a single gene encoding both subunits . This fusion represents a significant evolutionary divergence even among closely related Chloroflexi species.

The primary structure of C. aurantiacus pufL consists of 310 amino acids (positions 2-311 of the mature protein), containing multiple transmembrane domains that are crucial for its integration into the photosynthetic reaction center . The protein's hydrophobic regions facilitate its embedding within the membrane and interaction with photosynthetic pigments. When aligned with pufL proteins from purple bacteria, the C. aurantiacus version shows conservation in key functional domains responsible for pigment binding and electron transfer, while displaying unique regions that reflect its chimeric nature between green sulfur bacteria and purple bacteria photosystems .

Functionally, the C. aurantiacus pufL participates in a photosystem that differs from those in purple bacteria. The reaction center in C. aurantiacus receives excitation energy from chlorosomes containing bacteriochlorophyll c via the B808-866 light-harvesting complex , while purple bacteria typically use different light-harvesting complexes. These structural and functional variations reflect the adaptations of these organisms to their specific ecological niches and provide insights into the evolution of photosynthetic systems.

How does oxygen affect pufL expression and photosynthetic function in Chloroflexus aurantiacus?

Oxygen has a complex relationship with pufL expression and photosynthetic function in Chloroflexus aurantiacus. Unlike many anoxygenic photosynthetic bacteria that downregulate photosynthetic genes in the presence of oxygen, C. aurantiacus demonstrates a unique response pattern. Under aerobic conditions, C. aurantiacus produces significant amounts of bacteriochlorophylls in the presence of light, although this production is strongly suppressed in the dark . This indicates that light, rather than oxygen, is the primary regulatory factor for photosynthetic gene expression in this organism.

The transcription levels of photosynthesis-related genes, including pufL, are markedly increased by illumination even under aerobic conditions . This suggests that C. aurantiacus has evolved regulatory mechanisms that allow it to maintain photosynthetic capability in oxygenic environments as long as light is available. This adaptation enables C. aurantiacus to continuously synthesize ATP through photophosphorylation even in the presence of oxygen , providing a metabolic advantage in environments with fluctuating oxygen levels.

The dual capability for photosynthesis and aerobic respiration is reflected in the genome of C. aurantiacus, which contains duplicate genes and gene clusters for components of electron transport chains that function under different oxygen conditions . This genomic redundancy supports the organism's high tolerance for oxygen that has been reported in its growth characteristics , allowing it to thrive in environments with variable oxygen availability by switching between or combining photosynthetic and respiratory metabolism.

What are common issues in the heterologous expression of membrane proteins like pufL?

Heterologous expression of membrane proteins like pufL presents several challenges due to their hydrophobic nature and complex folding requirements. One common issue is protein misfolding and aggregation in inclusion bodies, which reduces the yield of functional protein . This can be addressed by optimizing expression conditions, such as lowering the induction temperature to 16-20°C, reducing inducer concentration, and using specialized E. coli strains designed for membrane protein expression.

Toxicity to the host cells is another frequent problem, as overexpression of membrane proteins can disrupt host membrane integrity. This can be mitigated by using tightly regulated expression systems and strains with enhanced membrane protein processing capabilities. Poor translocation to the membrane often occurs with heterologously expressed membrane proteins, resulting in cytoplasmic accumulation. Adding signal sequences compatible with the host's membrane insertion machinery can improve membrane targeting.

Improper folding is particularly challenging for complex membrane proteins like pufL. Co-expression with molecular chaperones and the addition of specific ligands or cofactors that stabilize the protein structure can enhance correct folding. Post-translational modifications required for function may be absent in heterologous hosts, necessitating the co-expression of modification enzymes. Finally, instability during purification is common, requiring careful optimization of detergent types and concentrations to maintain protein structure while extracting it from membranes .

How can protein aggregation be prevented during purification of recombinant pufL?

Preventing protein aggregation during purification of recombinant pufL requires a comprehensive strategy addressing multiple factors. Detergent selection is critical—mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin are often effective for membrane protein solubilization while preserving native structure . The detergent concentration should be optimized to remain above the critical micelle concentration (CMC) throughout the purification process.

Buffer composition plays a key role in preventing aggregation. Using Tris or phosphate buffers at pH 7.5-8.0 with 150-300 mM NaCl can help maintain protein stability . The addition of glycerol (10-20%) can reduce protein-protein interactions that lead to aggregation. Stabilizing agents like trehalose (6%) are particularly effective for maintaining the structural integrity of membrane proteins during purification and storage .

Temperature control is essential throughout the process. All purification steps should be performed at 4°C to minimize thermal denaturation and subsequent aggregation. Avoiding rapid temperature changes is equally important. Gentle handling techniques should be employed during all purification stages—using lower centrifugation speeds, avoiding vigorous mixing, and minimizing exposure to air-liquid interfaces can reduce mechanical denaturation.

The addition of specific ligands or cofactors that bind to the protein can significantly enhance stability. For pufL, including bacteriochlorophyll analogs in the purification buffers may help maintain the native conformation. Finally, rapid processing is crucial—minimizing the time between extraction and final purification steps reduces exposure to conditions that promote aggregation .

What strategies can overcome poor yield in recombinant pufL expression?

Improving yield of recombinant pufL protein requires a multi-faceted approach targeting various stages of the expression and purification process. Codon optimization of the pufL gene sequence for the expression host is fundamental, as rare codons can significantly reduce translation efficiency. This involves analyzing the codon usage bias of the expression host and modifying the gene sequence accordingly without altering the amino acid sequence.

Selecting an appropriate expression vector with an optimized promoter strength is critical. While strong promoters like T7 can increase protein expression, they may lead to inclusion body formation with membrane proteins. Medium-strength or inducible promoters often provide better results for membrane proteins like pufL. The addition of fusion partners or solubility tags beyond the standard His-tag can enhance solubility and expression levels. Tags like MBP (maltose-binding protein) or SUMO can improve folding and solubility of recalcitrant proteins.

Optimizing growth media composition can significantly impact yield. Enriched media or auto-induction media can provide necessary nutrients for sustained protein production. Media additives such as betaine, sorbitol, or specific metal ions required for protein folding may enhance functional protein yield. Expression in specialized host strains engineered for membrane protein expression, such as C41(DE3), C43(DE3), or Lemo21(DE3), often results in higher yields of functional protein.

Co-expression with molecular chaperones like GroEL/GroES or DnaK/DnaJ/GrpE can assist in proper protein folding. Similarly, co-expression with components that interact with pufL in its native environment (like pufM) may stabilize the protein and improve yield. Finally, scaling up culture volumes while maintaining optimized conditions can compensate for lower per-cell yield, ultimately providing sufficient protein for experimental needs .

What novel applications of pufL are emerging in synthetic biology?

Emerging applications of pufL in synthetic biology are expanding beyond traditional photosynthesis research. One groundbreaking direction involves the development of light-driven biocatalysis systems where pufL serves as a key component in engineered light-harvesting complexes. These systems couple light energy capture to enzymatic reactions, enabling light-driven biochemical transformations for the production of high-value compounds. The integration of pufL into artificial membranes or nanostructures is creating biohybrid materials with light-responsive properties for applications in biosensors and bioelectronics .

A particularly innovative approach involves incorporating pufL into synthetic modules for renewable energy applications. By combining recombinant pufL with electron transport components in engineered systems like NPM*, researchers are developing biogenic photosystems capable of converting light energy into cellular reducing power and ATP . These systems have potential applications in biofuel production, where light energy drives the synthesis of energy-dense molecules through biological carbon fixation pathways .

Additionally, pufL is being explored for its potential in optogenetic tools as an alternative to existing light-sensitive proteins. Its unique spectral properties and response to near-infrared light make it valuable for applications requiring deeper tissue penetration. The protein's ability to bind various modified pigment molecules also offers opportunities for spectral tuning, expanding the toolkit available for light-controlled biological systems .

How can structural biology techniques advance our understanding of pufL function?

Advanced structural biology techniques hold tremendous potential for elucidating the detailed molecular mechanisms of pufL function. Cryo-electron microscopy (cryo-EM) can reveal the three-dimensional structure of pufL within the entire photosynthetic reaction center complex at near-atomic resolution, providing insights into protein-protein and protein-pigment interactions that are crucial for its function. This technique is particularly valuable for membrane proteins like pufL that are challenging to crystallize.

X-ray crystallography, though challenging with membrane proteins, can provide high-resolution structural data if high-quality crystals can be obtained. Co-crystallization with binding partners or ligands can capture different functional states of the protein. Nuclear magnetic resonance (NMR) spectroscopy can complement these approaches by providing dynamic information about specific regions of pufL, particularly in solution state.

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions of pufL that undergo conformational changes during function or interaction with other components of the photosystem. This technique is particularly useful for mapping dynamic aspects of protein structure. Molecular dynamics simulations based on structural data can model the behavior of pufL within a lipid bilayer environment and predict how mutations might affect its function.

Combining these structural approaches with functional studies creates powerful platforms for structure-function analyses. For example, site-directed mutagenesis informed by structural data can identify key residues involved in pigment binding or electron transfer. Such integrated approaches will provide a comprehensive understanding of how pufL contributes to photosynthetic function at the molecular level.

What approaches are effective for studying pufL interactions with pigment molecules?

Studying the interactions between pufL and photosynthetic pigment molecules requires specialized techniques that can capture these specific molecular associations. Absorption and fluorescence spectroscopy are fundamental approaches that can detect characteristic spectral shifts when pigments bind to pufL, providing evidence of specific interactions. These techniques can also monitor energy transfer between different pigments within the protein complex.

Resonance Raman spectroscopy offers more detailed information about the vibrational modes of bound pigments, which are sensitive to their protein environment. This technique can identify specific amino acid residues involved in pigment binding and characterize the strength and nature of these interactions. Circular dichroism (CD) spectroscopy is particularly valuable for analyzing the chiral environment around bound pigments, providing information about their orientation within the protein binding pocket.

For more detailed structural analysis, X-ray crystallography or cryo-EM of pufL-pigment complexes can reveal the precise binding geometry and interacting residues at atomic resolution. These approaches require careful preparation of stable protein-pigment complexes but provide the most comprehensive structural information. Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can determine binding affinities and thermodynamic parameters of pufL-pigment interactions, quantifying the strength and nature of these associations.

Computational methods like molecular docking and molecular dynamics simulations can predict pigment binding sites and the effects of mutations on binding affinity. These in silico approaches are particularly valuable when combined with experimental validation through site-directed mutagenesis of predicted binding residues. The combination of these complementary techniques provides a comprehensive understanding of how pufL interacts with photosynthetic pigments to facilitate light energy capture and electron transfer .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.