Recombinant Chloroflexus aurantiacus Reaction center protein M chain (pufM)

Shipped with Ice Packs
In Stock

Description

Genomic and Operon Context

The pufM gene is co-transcribed with pufL (encoding the RC L subunit) in a unique operon arrangement distinct from purple bacteria. Notably:

  • In C. aurantiacus, pufL and pufM are adjacent but not fused, unlike in Roseiflexus castenholzii where these genes form a fusion .

  • The operon lacks genes for light-harvesting (LH) complexes, which are typically clustered with RC genes in purple bacteria .

Recombinant Production and Applications

Recombinant pufM is produced in E. coli for structural and functional studies. Key features include:

  • High-yield expression: Achieved using codon-optimized sequences and affinity chromatography .

  • Stability: Requires storage at -80°C with glycerol (50%) to prevent aggregation .

  • Research applications: Used to study RC assembly, electron transfer mechanisms, and evolutionary relationships among Type-2 RCs .

Functional Insights from Proteomics

Comparative proteomics of C. aurantiacus under phototrophic vs. chemotrophic conditions revealed:

  • Upregulation under anoxia: pufM is significantly abundant during phototrophic growth, alongside other RC proteins and enzymes in the 3-hydroxypropionate CO₂ fixation pathway .

  • Novel operon candidates: Five uncharacterized proteins co-expressed with pufM may regulate RC activity or chlorosome biogenesis .

Phylogenetic and Ecological Significance

  • Marker gene: pufM is widely used to study aerobic anoxygenic phototrophic (AAP) communities in diverse environments, from freshwater lakes to hypersaline habitats .

  • Evolutionary divergence: C. aurantiacus pufM forms a distinct clade within Chloroflexi, sharing <73% sequence similarity with Proteobacterial homologs .

Table 2: Key Interaction Partners of pufM (STRING Database)

Partner ProteinFunctionInteraction Score
pufLRC L subunit; mediates charge separation with pufM0.999
puf2CElectron donor to bacteriochlorophyll dimer0.999
bchLProtochlorophyllide reductase; involved in bacteriochlorophyll biosynthesis0.969
acsFCatalyzes cyclization step in chlorophyll synthesis0.903

Future Directions

Current research gaps include:

  • Structural resolution: No full crystal structure of C. aurantiacus RC is available, limiting mechanistic insights .

  • Ecological role: The activity of uncultured Chloroflexi expressing pufM in freshwater systems remains unexplored .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
pufM; Caur_1051; Reaction center protein M chain; Photosynthetic reaction center M subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-307
Protein Length
Full Length of Mature Protein
Species
Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Target Names
pufM
Target Protein Sequence
ATINMTPGDLELGRDRGRIGKPIEIPLLENFGFDSQLGPFYLGFWNAVAYITGGIFTFIW LMVMFAQVNYNPVAFAKYFVVLQIDPPSSRYGLSFPPLNEGGWWLIATFFLTVSIFAWYM HIYTRAKALGIKPYLAYGFTGAIALYLVIYIIRPVWMGDWSEAPAHGIKALLDWTNNVSV RYGNFYYNPFHMLSIFFLLGSTLLLAMHAGTIWALEKYAAHEEWNEIQAPGTGTERAQLF WRWCMGFNANAYSIHLWAFWFAWLCGITGALGVFFSMPDFVNNWFQWGIEAGINYPQGPT PPVSLP
Uniprot No.

Target Background

Function
The reaction center is a membrane-bound complex that facilitates the initial photochemical event in the electron transfer process of photosynthesis.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the C. aurantiacus M-subunit differ from that of purple bacteria?

The M-subunit of C. aurantiacus has several distinctive features that differentiate it from purple bacterial reaction centers:

  • It has a blocked N-terminus, limiting direct N-terminal sequencing

  • The essential histidine that normally coordinates magnesium in the accessory bacteriochlorophyll of purple bacteria is replaced by leucine in C. aurantiacus

  • Amino acid sequence similarity between C. aurantiacus M-subunit and Rhodobacter sphaeroides M-subunit is approximately 42%

  • Despite these differences, C. aurantiacus synthesizes a purple bacterial-type reaction center while being a green nonsulfur bacterium, representing an interesting evolutionary case

What is the relationship between C. aurantiacus and other photosynthetic bacteria?

C. aurantiacus occupies a unique position in photosynthetic bacteria classification:

CharacteristicC. aurantiacusPurple Bacteria
Taxonomic groupGreen nonsulfur bacteria (Chloroflexi)Proteobacteria (α, β, γ classes)
Reaction center typeType II (purple bacterial-type)Type II
Growth conditionsThermophilic, filamentous, anoxygenic phototrophVaries by species, typically mesophilic
Phylogenetic markersBoth green nonsulfur bacterial 16S rDNA and pufM genepufM gene
pufM sequence similarityBase for comparison20-42% identity with different species

C. aurantiacus serves as the model organism for the phylum Chloroflexi but possesses a reaction center similar to those found in phylogenetically distant purple bacteria .

What are the recommended methods for recombinant expression of the pufM protein?

Based on studies of other C. aurantiacus proteins and reaction center proteins from related organisms, a methodological approach would include:

  • Gene Cloning:

    • Isolate the pufM gene from C. aurantiacus genomic DNA using PCR with specific primers

    • Clone into an appropriate expression vector with a strong promoter and suitable tag for purification

  • Expression System:

    • Escherichia coli BL21(DE3) has been successfully used for other C. aurantiacus proteins

    • Consider membrane protein expression systems for better folding

  • Expression Conditions:

    • Induce at lower temperatures (16-25°C) to enhance proper folding

    • Include cofactors such as bacteriochlorophylls during expression or refolding

  • Purification Strategy:

    • Solubilize membranes with mild detergents if the protein associates with membranes

    • Use affinity chromatography based on the fusion tag

    • Consider size exclusion chromatography for final purification

  • Storage Conditions:

    • Store in Tris-based buffer with 50% glycerol at -20°C

    • For extended storage, preserve at -80°C

    • Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week

What are the challenges in purifying membrane-associated reaction center proteins?

Purification of membrane proteins like pufM presents several methodological challenges:

  • Maintaining Native Structure:

    • Need for detergent micelles to stabilize the protein in aqueous solution

    • Risk of pigment loss during extraction from membranes

    • Challenge of maintaining protein-pigment interactions

  • Detergent Selection:

    • Different detergents affect protein stability and activity differently

    • Need to optimize detergent type and concentration

  • Preserving Cofactor Binding:

    • Bacteriochlorophylls and other cofactors can dissociate during purification

    • Native mass spectrometry studies show gradual release of chlorophyll pigments with increasing collision energy

  • Functional Assessment:

    • Need specialized assays to verify that the purified protein retains its photosynthetic activity

How can researchers detect and study pufM expression in environmental samples?

The pufM gene serves as an excellent marker for studying anoxygenic phototrophs in environmental samples:

  • PCR-Based Detection:

    • Use pufM-specific primers that target conserved regions of the gene

    • The primers detect any organism with a purple bacterial-type reaction center, including both purple bacteria (Proteobacteria) and C. aurantiacus

  • Distinguishing Bacterial Types:

    • Use both pufM primers and green nonsulfur bacterial 16S rDNA primers

    • A positive pufM and negative green nonsulfur bacterial result would conclusively indicate purple bacteria

  • Functional Gene Expression Analysis:

    • Employ reverse transcriptase PCR with pufM primers to detect actively transcribed mRNA

    • This approach allows determination of whether photosynthetic metabolism is occurring in a specific environment

  • Recommended Protocol:

    • Extract total DNA from environmental samples

    • Amplify using pufM-specific primers (229-bp amplification product expected)

    • Confirm by sequencing and comparison to known pufM sequences

    • For expression studies, extract RNA, perform reverse transcription, and then PCR

What spectroscopic methods are effective for analyzing the C. aurantiacus reaction center?

Researchers can employ several spectroscopic techniques to study the reaction center properties:

  • Absorption Spectroscopy:

    • Characteristic peaks for the reaction center provide information about pigment incorporation

    • Enables monitoring of the formation of pigment-protein complexes

  • Ultra-Broadband 2D Electronic Spectroscopy:

    • Allows tracking of excitation energy transfer (EET) pathways

    • Can simultaneously track dynamics of photoexcited components

    • Useful for studying the interactions between bacteriochlorophylls and other pigments

  • Native Mass Spectrometry:

    • Can characterize membrane-embedded reaction center complexes in near-native states

    • Reveals stoichiometry and topology of the protein complex

    • Provides insights into the strength of pigment interactions

  • Time-Resolved Spectroscopy:

    • Measures electron transfer kinetics within the reaction center

    • Characterizes the functional performance of the reaction center

How does the proteome of C. aurantiacus differ under different growth conditions?

High-throughput, liquid chromatography-mass spectrometry analysis of C. aurantiacus cells has revealed significant differences between oxic (chemoorganoheterotrophic) and anoxic (photoorganoheterotrophic) growth conditions:

  • Photosynthesis-Related Proteins:

    • 242 proteins were either uniquely identified or significantly increased in abundance under photoheterotrophic conditions

    • 54 of these are previously characterized photosynthesis-related proteins, including:

      • Chlorosome proteins

      • Proteins involved in bacteriochlorophyll biosynthesis

      • Enzymes of the 3-hydroxypropionate (3-OHP) CO₂ fixation pathway

      • Components of electron transport chains

  • Novel Photosynthesis-Associated Proteins:

    • 188 proteins with significantly increased abundance under photoheterotrophic conditions have not been previously characterized in relation to photosynthesis

    • Five proteins were identified as being encoded by a novel operon and observed only in photoheterotrophically grown cells

  • Methodological Approach:

    • Culture C. aurantiacus under both oxic and anoxic conditions

    • Extract and process proteins for LC-MS/MS analysis

    • Perform comparative quantitative proteomics analysis

    • Identify proteins with differential abundance

    • Functionally categorize proteins based on annotation and homology

What structural features differentiate the puf operon of C. aurantiacus from that of purple bacteria?

The puf operon organization shows important differences between C. aurantiacus and purple bacteria:

  • Gene Organization:

    • Purple bacteria like Rhodobacter sphaeroides typically have a puf operon with the order pufBALMC

    • Some purple bacteria also contain additional genes like pufX that are important for light-harvesting complex function

  • Sequence Similarity:

    • The pufC (cytochrome c subunit) sequences show varying degrees of similarity between species

    • C. aurantiacus shows only 20% identical amino acids with Rhodobacter species, the lowest similarity compared to other purple bacteria (which show 31-44% similarity)

  • Structural Implications:

    • Despite low sequence identity, the global structure of these proteins is thought to be conserved based on structural and biochemical data

    • The hydrophobic domains and heme-binding regions show conservation patterns that suggest functional constraints on evolution

What strategies can be employed to study the interaction between pufM and other components of the photosynthetic apparatus?

Advanced techniques to investigate protein-protein interactions in the photosynthetic complex include:

  • Cross-linking Mass Spectrometry:

    • Use chemical cross-linkers to capture transient interactions

    • Digest cross-linked proteins and analyze by mass spectrometry

    • Map interaction interfaces between pufM and other reaction center proteins

  • Cryo-electron Microscopy:

    • Determine high-resolution structures of the entire reaction center complex

    • Visualize the arrangement of pufM relative to other components

    • Identify structural features that mediate protein-pigment interactions

  • Site-directed Mutagenesis:

    • Create specific mutations in the pufM sequence

    • Analyze effects on complex assembly and function

    • Identify residues critical for protein-protein and protein-pigment interactions

  • Reconstitution Experiments:

    • Express and purify individual components

    • Reconstitute functional complexes in vitro

    • Assess the requirements for proper assembly

How can the unique features of C. aurantiacus pufM be exploited in biotechnological applications?

The distinctive properties of C. aurantiacus as a thermophilic photosynthetic bacterium offer several biotechnological opportunities:

  • Thermostable Biocatalysts:

    • The thermophilic nature of C. aurantiacus proteins (including pufM) makes them potential candidates for applications requiring thermal stability

    • Other enzymes from C. aurantiacus have already shown promising biotechnological applications, such as α-L-rhamnosidase for isoquercitrin production

  • Photosynthetic Biosensors:

    • The pufM protein could be engineered as part of biosensing systems that detect environmental changes through alterations in photosynthetic activity

    • The unique spectral properties could be utilized for detection applications

  • Synthetic Biology Applications:

    • Heterologous expression of C. aurantiacus puf genes in other bacteria has been demonstrated, suggesting potential for synthetic biology approaches

    • The pufM gene could be incorporated into designer organisms with enhanced or modified photosynthetic capabilities

  • Evolution and Adaptation Studies:

    • As C. aurantiacus occupies an interesting evolutionary position (green nonsulfur bacteria with purple bacterial-type reaction center), studying pufM can provide insights into the evolution of photosynthesis

    • This knowledge could inform the design of artificial photosynthetic systems

What are common challenges in heterologous expression of membrane proteins like pufM?

Researchers commonly encounter several issues when expressing membrane proteins such as pufM:

  • Protein Aggregation:

    • Membrane proteins often form inclusion bodies when overexpressed

    • Solution: Lower induction temperature, use specialized expression hosts, or employ fusion tags that enhance solubility

  • Improper Folding:

    • The complex structure of reaction center proteins makes correct folding challenging

    • Solution: Co-express with chaperones or partner proteins that assist folding

  • Cofactor Incorporation:

    • Bacteriochlorophylls and other cofactors must be properly incorporated

    • Solution: Supplement growth media with precursors or reconstitute with purified cofactors after protein purification

  • Detergent Selection:

    • Different detergents can significantly affect protein stability and activity

    • Solution: Screen multiple detergents and optimize concentrations; consider amphipols or nanodiscs for improved stability

  • Verification of Functional Activity:

    • Confirming that the recombinant protein retains native function

    • Solution: Develop spectroscopic assays to verify pigment binding and electron transfer capabilities

How can researchers optimize PCR-based detection of pufM in complex environmental samples?

For reliable detection of pufM in environmental samples, consider these methodological recommendations:

  • Primer Design and Optimization:

    • Use degenerate primers that account for sequence variations among different species

    • Optimize PCR conditions specifically for environmental samples (template concentration, cycle number, annealing temperature)

  • DNA Extraction Methods:

    • Use extraction protocols optimized for environmental samples that may contain PCR inhibitors

    • Consider multiple extraction methods to ensure comprehensive recovery of target DNA

  • Verification Strategies:

    • Sequence PCR products to confirm specificity

    • Use positive controls from known pufM-containing organisms (both purple bacteria and C. aurantiacus)

  • Quantitative Analysis:

    • Employ qPCR for quantitative assessment of pufM abundance

    • Use internal standards for accurate quantification

  • Combined Approaches:

    • Use both 16S rRNA gene analysis and functional gene (pufM) detection for comprehensive characterization

    • This dual approach allows distinguishing between purple bacteria and green nonsulfur bacteria containing purple bacterial-type reaction centers

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.