Recombinant Caur_0899 is produced as a 597-amino acid protein fused to an N-terminal His tag. Key specifications include:
The amino acid sequence includes conserved domains typical of histidine kinases, such as a dimerization histidine phosphotransfer (DHp) domain and a catalytic ATP-binding (CA) domain . A partial sequence is provided below:
MTSPAKSSTAASSSSQRSLSAWSPLGGERFYAAARWVLIILLGVVTQFLTNGGLWPVTDE... .
C. aurantiacus is a thermophilic, filamentous bacterium isolated from hot springs (50–60°C) . Its metabolic versatility includes:
Photoheterotrophy: Utilizes organic carbon sources under anaerobic, light-dependent conditions .
Thermotolerance: Adaptations to high-temperature environments, potentially linked to stable protein folding .
KEGG: cau:Caur_0899
STRING: 324602.Caur_0899
Chloroflexus aurantiacus is a photosynthetic bacterium isolated from hot springs that belongs to the green non-sulfur bacteria group (though this classification is considered obsolescent). This organism is thermophilic, capable of growing at temperatures ranging from 35 to 70°C (95 to 158°F) . The significance of C. aurantiacus for histidine kinase research stems from its adaptability to extreme environments, which potentially influences the structure and function of its signaling proteins. As a thermophilic organism, its proteins, including histidine kinases, may possess enhanced stability properties that facilitate structural studies .
The bacterium exhibits remarkable metabolic versatility, being able to survive in the dark when oxygen is available (appearing dark orange) or in sunlight (appearing dark green) . This metabolic flexibility suggests sophisticated sensing and signaling mechanisms, likely involving histidine kinases like Caur_0899. The thermostable nature of proteins from C. aurantiacus makes them valuable models for understanding fundamental mechanisms of histidine kinase function that may be more difficult to study in mesophilic counterparts where protein instability can complicate experimental approaches.
Sensor histidine kinases (HKs) are multifunctional enzymes possessing autokinase, phosphotransfer, and phosphatase activities, with most functioning as transmembrane sensor proteins . These proteins feature conserved cytoplasmic phosphorylation and ATP-binding kinase domains, which are essential for their enzymatic activities . Their structural organization typically includes:
An extracellular sensing domain that detects environmental signals
Transmembrane helices that anchor the protein and transmit signals
A cytoplasmic region containing:
The signaling mechanism involves detection of environmental stimuli by the sensor domain, signal transmission through the transmembrane region to the DHp domain, and subsequent autophosphorylation of a conserved histidine residue . This phosphoryl group is then typically transferred to a response regulator, which mediates the cellular response to the detected signal. Histidine kinase receptors function as homodimers, though the precise mechanism of signal transduction across cell membranes remains incompletely understood .
Proper storage and handling of the recombinant Caur_0899 protein is critical for maintaining its structural integrity and functional activity. The recommended storage conditions include:
Long-term storage: -20°C to -80°C, with -80°C preferred for extended periods
Storage buffer: Tris/PBS-based buffer containing 6% trehalose at pH 8.0
When reconstituting the lyophilized protein, researchers should:
Briefly centrifuge the vial before opening to bring contents to the bottom
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) for cryoprotection
Prepare multiple small aliquots to avoid repeated freeze-thaw cycles
Repeated freezing and thawing should be strictly avoided as this can lead to protein denaturation and loss of activity . The addition of glycerol serves as a cryoprotectant that helps prevent ice crystal formation during freezing, thereby preserving protein structure and function. For experimental work requiring prolonged manipulations, it is advisable to maintain the protein at 4°C rather than repeatedly returning it to freezer storage.
Bioinformatic analysis of histidine kinase sensor domains has identified distinct structural families, with the largest being Family HK1, characterized by inserted repeats of PhoQ/DcuS/CitA (PDC) domains . While specific structural information about Caur_0899 is not directly available in the search results, analysis of related histidine kinases provides valuable insights.
Sensor domains of histidine kinases typically reside in the extracellular region, positioned between two transmembrane helices (TM1 and TM2) . Crystal structures of representative sensor domains reveal that those from the predominant family contain double-PDC domains . The correlation between sequence and structural similarity across these double-PDC sensor proteins suggests a conserved architectural framework that may be relevant to Caur_0899.
Three key structural characteristics of sensor domains include:
Dimeric organization: Many HK1-family sensor domains crystallize as dimers, which appears to be physiologically relevant
Signal-induced conformational changes: Comparisons between ligand-bound and apo-state structures provide insights into signal transmission mechanisms
Modular organization: The sensor domains exhibit varied organizations reflecting the diversity of signals they detect
Understanding these structural features is essential for elucidating the signal transduction mechanism of Caur_0899, as conformational changes within the sensor domain are likely transmitted through the transmembrane helices to influence the activity of the cytoplasmic kinase domain.
Investigating the signal transduction mechanism of Caur_0899 requires a multifaceted approach combining structural, biochemical, and biophysical techniques. Based on studies of related histidine kinases, the following experimental strategies would be most effective:
Structural analysis:
Functional assays:
Autophosphorylation assays using to monitor kinase activity
Phosphotransfer assays to identify cognate response regulators
Phosphatase activity assays to assess the full enzymatic repertoire
Conformational dynamics studies:
Hydrogen-deuterium exchange mass spectrometry to identify regions undergoing conformational changes
FRET-based sensors to monitor domain movements in real-time
Site-directed spin labeling combined with EPR spectroscopy to measure distances between specific residues
Ligand identification:
Chemical library screening to identify potential ligands
Isothermal titration calorimetry to measure binding affinities
Differential scanning fluorimetry to assess thermal stability shifts upon ligand binding
The first crystal structure of a complete cytoplasmic region of a sensor histidine kinase (from Thermotoga maritima) provided valuable insights into domain organization and inspired hypotheses about autophosphorylation, phosphotransfer, and signal transduction mechanisms . Similar approaches applied to Caur_0899 could yield comparable insights, especially when complemented with functional studies to validate structural observations.
The thermophilic nature of Chloroflexus aurantiacus, which can grow at temperatures ranging from 35 to 70°C , significantly impacts experimental design when studying Caur_0899. This characteristic introduces both advantages and challenges that researchers must consider:
Advantages:
Enhanced protein stability, potentially facilitating structural studies by reducing conformational heterogeneity
Resistance to denaturation during purification and crystallization processes
Possibility of conducting enzymatic assays at elevated temperatures, which may better reflect native activity conditions
Challenges:
Standard expression systems like E. coli may produce incorrectly folded protein if optimal folding requires high temperatures
Buffer systems and reagents must be compatible with elevated temperatures for functional assays
Potential conformational differences between room temperature and physiological (thermophilic) temperatures may affect interpretations
Recommended experimental adaptations:
| Experimental Aspect | Standard Approach | Adaptation for Caur_0899 |
|---|---|---|
| Expression system | E. coli at 37°C | Consider heat shock during expression or thermophilic expression systems |
| Purification | Room temperature | Include heat treatment step (55-60°C) to leverage thermostability for purification |
| Functional assays | 25-37°C | Perform parallel assays at 25°C, 37°C, and 55-60°C to assess temperature dependence |
| Buffer selection | Standard buffers | Use buffers with minimal temperature-dependent pH changes; test stability at elevated temperatures |
| Crystallization | 4-20°C | Attempt crystallization at higher temperatures (30-40°C) |
Researchers studying proteins from thermophiles often find that these proteins may be catalytically inactive or structurally different at room temperature compared to their native elevated temperature environment. Therefore, temperature should be treated as a critical variable in all experimental designs involving Caur_0899.
Expressing and purifying functional Caur_0899 for structural studies presents several challenges that researchers must overcome:
Membrane protein expression:
Caur_0899 contains transmembrane regions, making it challenging to express in conventional systems. The hydrophobic nature of these regions can lead to protein aggregation, misfolding, or toxicity to the host cell.
Maintaining native conformation:
The thermophilic origin of Caur_0899 means that its native conformation may be optimized for higher temperatures, potentially complicating expression in mesophilic hosts like E. coli .
Preserving sensor domain functionality:
The sensor domain must maintain its ability to respond to stimuli, which may be compromised during purification, especially if the natural ligand is unknown or not included.
Stabilizing the dimeric state:
Histidine kinases function as dimers , and maintaining the physiologically relevant dimeric state during purification is essential for structural studies that aim to capture the native conformation.
Strategies to address these challenges:
Expression optimization:
Purification refinement:
Employ gentle detergents for membrane protein extraction
Include potential ligands or stabilizing molecules throughout purification
Utilize size exclusion chromatography to isolate properly folded dimeric species
Construct design:
Create truncated constructs that eliminate transmembrane regions while preserving functional domains
Design chimeric proteins where the transmembrane regions are replaced with soluble dimerization domains
Develop domain-specific constructs for targeted structural studies
Identifying the signaling partners and pathways for the uncharacterized Caur_0899 histidine kinase requires a combination of bioinformatic, genetic, and biochemical approaches:
Bioinformatic prediction:
Genomic context analysis to identify genes co-localized with Caur_0899, particularly response regulators
Phylogenetic profiling to find proteins with similar evolutionary patterns across species
Protein-protein interaction network prediction based on sequence features
In vitro phosphotransfer profiling:
Systematic phosphotransfer assays with recombinant Caur_0899 and candidate response regulators
Phosphoproteomics to identify proteins phosphorylated in the presence of active Caur_0899
Pull-down assays using immobilized Caur_0899 followed by mass spectrometry identification
Genetic approaches:
Gene knockout studies in C. aurantiacus to identify phenotypes associated with Caur_0899 deletion
Suppressor mutation analysis to identify genes that can compensate for Caur_0899 dysfunction
Transcriptome analysis comparing wild-type and Caur_0899 mutant strains under various conditions
Heterologous expression systems:
Complementation studies in histidine kinase mutants from model organisms
Bacterial two-hybrid systems to screen for protein-protein interactions
Synthetic biology approaches to reconstitute signaling pathways in non-native hosts
Given that some histidine kinase sensor domains have been found to interact with chemotaxis proteins or diguanylate cyclase receptors , researchers should consider these as potential signaling partners for Caur_0899. The modular nature of two-component signaling systems suggests that combinatorial molecular evolution may have generated diverse signaling networks , requiring comprehensive approaches to fully map the signaling landscape of Caur_0899.
Site-directed mutagenesis represents a powerful approach for investigating the structure-function relationships within Caur_0899. Based on studies of other histidine kinases, the following mutagenesis strategies can provide valuable insights:
Conserved residue targeting:
Based on sequence alignments with characterized histidine kinases, identify and mutate highly conserved residues in:
The histidine phosphorylation site in the DHp domain
The ATP-binding site in the kinase domain
Potential dimeric interface regions
Predicted ligand-binding sites in the sensor domain
Domain deletion and swap experiments:
Generate truncation constructs to isolate individual domains
Create chimeric proteins by swapping domains with well-characterized histidine kinases
Introduce heterologous sensor domains to alter input specificity
Systematic scanning mutagenesis:
Alanine scanning of transmembrane regions to identify residues critical for signal transmission
Cysteine scanning to introduce crosslinking or fluorescent labels at specific positions
Charge reversal mutations to probe electrostatic interactions
Mutation analysis matrix:
| Domain | Target Residues | Mutation Type | Expected Effect | Functional Assay |
|---|---|---|---|---|
| Sensor | Predicted ligand-binding residues | Conservative substitutions | Altered ligand specificity | Ligand binding assays |
| Transmembrane | Hydrophobic residues | Polar substitutions | Disrupted signal transmission | Autophosphorylation assays |
| DHp | Conserved histidine | H→A substitution | Abolished phosphorylation | Phosphotransfer assays |
| Kinase | ATP-binding residues | Conservative substitutions | Altered catalytic efficiency | Kinetic analysis |
| Dimerization interface | Interface residues | Bulky side chains | Disrupted dimerization | Size exclusion chromatography |
Studies with other histidine kinases have shown that interdomain contacts are functionally relevant, and mutational tests can support hypotheses about autophosphorylation mechanisms, phosphotransfer, and signal transduction . By applying similar approaches to Caur_0899, researchers can map the functional architecture of this uncharacterized sensor-like histidine kinase.
The study of Caur_0899 from Chloroflexus aurantiacus carries significant implications for our understanding of bacterial signaling systems beyond this specific protein. As an uncharacterized sensor-like histidine kinase from a thermophilic organism, Caur_0899 represents an opportunity to explore several fundamental aspects of bacterial signal transduction:
Evolutionary diversity of sensing mechanisms:
The diverse organization of sensor domains reflects the variety of signals detected in two-component signaling . Characterizing Caur_0899 contributes to our understanding of how these sensing mechanisms evolved and diversified across bacterial species, particularly in extremophiles.
Thermostable signaling proteins:
The thermophilic nature of C. aurantiacus (growing at temperatures up to 70°C) suggests that Caur_0899 possesses structural adaptations for functioning at elevated temperatures. These adaptations may reveal general principles about protein stability that could be applied to protein engineering efforts.
Novel antibiotic targets:
Two-component signaling systems are prevalent in bacteria, plants, fungi, and protists but absent in metazoan animals, making them potential targets for novel antibiotics . Understanding the structure and function of diverse histidine kinases like Caur_0899 could contribute to the development of broad-spectrum antibacterial compounds that target conserved features of these signaling systems.
Environmental adaptation mechanisms:
C. aurantiacus exhibits remarkable metabolic versatility, growing photosynthetically in sunlight or chemoheterotrophically in darkness . The signaling systems mediating these adaptations, potentially including Caur_0899, provide insights into how bacteria sense and respond to changing environmental conditions.
The molecular mechanisms underlying signal transduction in histidine kinases remain incompletely understood, with questions about how signals are transmitted across membranes and how conformational changes propagate through the protein . Studies of diverse histidine kinases like Caur_0899 will help fill these knowledge gaps, contributing to a more comprehensive model of bacterial signal transduction.
Based on the current state of knowledge about Caur_0899 and related histidine kinases, several research directions warrant prioritization:
Ligand identification:
Determining the environmental signal(s) detected by Caur_0899 is fundamental to understanding its biological function. High-throughput screening approaches combined with structural studies would help identify potential ligands.
Complete structural characterization:
Obtaining high-resolution structures of both the full-length protein and individual domains in different functional states would provide critical insights into the signal transduction mechanism. Particular emphasis should be placed on capturing the conformational changes associated with signaling.
Identification of cognate response regulators:
Mapping the signaling network downstream of Caur_0899 by identifying its cognate response regulator(s) would place this protein in its proper cellular context and reveal its physiological role.
In vivo functional studies:
Developing genetic tools for C. aurantiacus to study the phenotypic effects of Caur_0899 deletion or mutation would elucidate its biological significance in the native organism.
Comparative analysis with mesophilic homologs: Systematic comparison of Caur_0899 with homologous proteins from mesophilic bacteria would highlight adaptations specific to thermophilic environments and reveal conserved functional principles.