Recombinant Chloroherpeton thalassium NADH-quinone oxidoreductase subunit A 1 (nuoA1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
nuoA1; Ctha_2024; NADH-quinone oxidoreductase subunit A 1; NADH dehydrogenase I subunit A 1; NDH-1 subunit A 1; NUO1 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Target Names
nuoA1
Target Protein Sequence
MLESYFPIFVVISIAIILAVVLLSIGKIIGPKRNNPEKLTPYESGMDPVGSTRTRVTVRF YLVAMIFIVFDIEVIFMYPWAVSFRELSGFYGLIPMVTFVLILLAGYYYILKKKALDWDE E
Uniprot No.

Target Background

Function
NDH-1 (NADH-quinone oxidoreductase subunit A 1) facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, the primary electron acceptor is thought to be a menaquinone. This redox reaction is coupled to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thereby conserving energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chloroherpeton thalassium and what makes it significant for bioenergetic research?

Chloroherpeton thalassium is a marine green sulfur bacterium isolated from the North East coast of the USA. It is distinguished by its flexing and gliding motility, which is unusual among green sulfur bacteria. This obligate phototroph requires both CO2 and sulfide (S2-) for growth, with some organic acids potentially contributing to cell carbon. The organism contains typical chlorosomes as light-harvesting structures, with bacteriochlorophyll c serving as the main light-harvesting pigment and bacteriochlorophyll a present in smaller quantities. Approximately 80% of its carotenoid content is gamma-carotene, and its DNA base composition ranges from 45.0-48.2 mol% G+C . Its unique position in bacterial phylogeny and specialized energy metabolism make it valuable for investigating evolutionary adaptations to marine phototrophic lifestyles.

How does nuoA1 relate to the complete NADH-quinone oxidoreductase complex?

The nuoA1 subunit represents one of the membrane-embedded components of the NADH-quinone oxidoreductase complex. While specific structural information for Chloroherpeton thalassium's nuoA1 is not extensively documented, comparative analysis with related organisms suggests that nuoA1 likely contributes to the proton-pumping machinery of Complex I. The "A1" designation may indicate that Chloroherpeton thalassium possesses multiple variants of this subunit, potentially reflecting adaptations to different environmental conditions or metabolic states. This parallels observations in the related green sulfur bacterium Chlorobaculum tepidum, which contains multiple homologs of sulfide:quinone oxidoreductase (SQR) with distinct functional roles and expression patterns depending on sulfide availability .

What expression systems are recommended for producing recombinant Chloroherpeton thalassium nuoA1?

For expression of recombinant Chloroherpeton thalassium nuoA1, E. coli-based systems represent a practical starting point due to their well-established protocols for membrane protein expression. When working with nuoA1, consider using expression vectors incorporating a C-terminal His-tag approach, similar to the successful strategy employed for CT1087 (an SQR protein) in Chlorobaculum tepidum . For optimal expression, specialized E. coli strains such as C41(DE3) or C43(DE3), which are engineered for membrane protein production, may prove advantageous. Alternative expression hosts including Pseudomonas systems might also be considered as Pseudomonas aeruginosa has been documented as an expression host for nuoA1 proteins . Expression protocols should incorporate temperature modulation (typically 18-25°C post-induction) to enhance proper folding of this membrane protein.

What are the critical considerations for purifying functional nuoA1?

Purification of functional nuoA1 requires careful attention to maintaining the native membrane environment or providing suitable alternatives. A recommended methodology includes:

  • Membrane fraction isolation: After cell lysis, differential centrifugation (typically 10,000 × g to remove debris, followed by 100,000 × g to collect membranes) effectively isolates the membrane fraction containing nuoA1.

  • Detergent selection: Critical for solubilizing nuoA1 while preserving structure and function. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin at 1-2% (w/v) are recommended starting points.

  • Affinity chromatography: If using His-tagged constructs, immobilized metal affinity chromatography (IMAC) with Ni-NTA resin under optimized imidazole gradients (typically 20 mM for washing, 250-300 mM for elution) can achieve initial purification.

  • Secondary purification: Size exclusion chromatography using appropriate columns (e.g., Superdex 200) equilibrated with buffer containing 0.02-0.05% detergent helps remove aggregates and improves homogeneity.

Throughout all purification steps, buffers should contain stabilizing agents (glycerol 10-15%) and potentially sulfide or other relevant cofactors to maintain native conformation.

How can researchers verify the functional integrity of purified recombinant nuoA1?

Verifying functional integrity requires multiple complementary approaches:

  • Spectroscopic assessment: UV-visible spectroscopy can detect potential cofactor binding, while circular dichroism provides information about secondary structure integrity, particularly important for alpha-helical membrane proteins like nuoA1.

  • Activity assays: Ubiquinone reduction activity can be monitored spectrophotometrically using artificial electron donors. Protocols similar to those used for SQR activity assessment in Chlorobaculum tepidum (measuring the reduction of decylubiquinone at 275 nm with extinction coefficient of 12.5 mM−1 cm−1) may be adapted .

  • Reconstitution tests: Incorporating purified nuoA1 into liposomes and measuring proton pumping activity using pH-sensitive fluorescent dyes provides functional validation in a membrane-like environment.

  • Structural integrity: Limited proteolysis followed by mass spectrometry can identify properly folded domains resistant to digestion versus exposed, potentially misfolded regions.

What spectroscopic methods are most informative for studying nuoA1 function?

Several spectroscopic methods provide valuable insights into nuoA1 function:

  • EPR (Electron Paramagnetic Resonance) spectroscopy: Particularly useful for studying the iron-sulfur clusters that likely interact with nuoA1 in the complete Complex I. X-band EPR (9-10 GHz) can identify paramagnetic species and their redox states at temperatures typically between 5-100K.

  • FTIR (Fourier Transform Infrared) difference spectroscopy: Enables detection of conformational changes associated with proton pumping activity by monitoring alterations in protein structure during catalytic turnover.

  • Resonance Raman spectroscopy: Provides information about quinone binding and potential chromophores associated with nuoA1 function.

  • Fluorescence-based techniques: Including FRET (Förster Resonance Energy Transfer) can elucidate interactions between nuoA1 and other subunits or electron carriers when appropriately labeled.

These methods are particularly valuable given that green sulfur bacteria like Chloroherpeton thalassium have evolved specialized light-harvesting apparatus with characteristic spectroscopic signatures, including bacteriochlorophyll c (main absorption maxima around 750 nm) and bacteriochlorophyll a (absorption around 800 nm) .

How can researchers investigate the interaction of nuoA1 with quinones in vitro?

Investigating nuoA1-quinone interactions requires specialized approaches:

  • Isothermal Titration Calorimetry (ITC): Provides direct measurement of binding thermodynamics between purified nuoA1 and various quinone analogs, including binding affinity (Kd), stoichiometry, and thermodynamic parameters (ΔH, ΔS).

  • Surface Plasmon Resonance (SPR): Enables real-time monitoring of quinone binding to immobilized nuoA1, yielding kinetic parameters (kon, koff) and revealing potential multi-step binding mechanisms.

  • Photoreactive quinone analogs: Derivatives with photolabile groups can be used for crosslinking studies to identify specific quinone-binding residues through subsequent mass spectrometry analysis.

  • Fluorescence quenching: The natural fluorescence of tryptophan residues in nuoA1 may be quenched upon quinone binding, providing a direct readout of interaction.

For enzyme kinetic measurements, a standardized assay monitoring the decrease in absorbance at 340 nm due to NADH oxidation in the presence of exogenous quinones (typically decylubiquinone at 50-100 μM) would provide activity parameters including Km, Vmax, and potential inhibition patterns.

What structural analysis approaches provide the greatest insights into nuoA1?

For structural analysis of nuoA1, researchers should consider:

  • Cryo-electron microscopy (cryo-EM): Currently the gold standard for membrane protein structural determination, potentially achieving 3-4 Å resolution for nuoA1 either in isolation or as part of the complete Complex I. Sample preparation should include screening multiple detergents and nanodiscs to identify optimal conditions.

  • X-ray crystallography: Despite challenges with membrane proteins, lipidic cubic phase crystallization has proven successful for similar proteins. Vapor diffusion screening with detergent-solubilized nuoA1 supplemented with specific lipids from Chloroherpeton thalassium may yield diffraction-quality crystals.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides information about protein dynamics and solvent accessibility, revealing flexible regions and potential conformational changes under different conditions without requiring crystallization.

  • Cross-linking mass spectrometry (XL-MS): Identifies spatial relationships between residues, helping map interaction surfaces between nuoA1 and neighboring subunits when using bifunctional crosslinkers of defined lengths.

  • Small-angle X-ray scattering (SAXS): Offers low-resolution structural information about protein shape and envelope in solution, valuable for validating structural models.

How does nuoA1 contribute to the bioenergetic adaptations of Chloroherpeton thalassium in low-light environments?

Chloroherpeton thalassium, like other green sulfur bacteria, has evolved to thrive in low-light environments where photon flux can be as low as 0.02-10% of surface light intensity . The nuoA1 subunit likely plays a crucial role in this adaptation through several mechanisms:

  • Enhanced proton pumping efficiency: The nuoA1 subunit may contain specialized residues that optimize proton translocation relative to electron transfer, maximizing energy conservation from limited photosynthetic input.

  • Integration with sulfide metabolism: Similar to the sulfide:quinone oxidoreductase (SQR) systems in the related Chlorobaculum tepidum, nuoA1 likely participates in a refined electron transport chain that effectively couples sulfide oxidation to energy conservation .

  • Adaptation to low maintenance energy: Chlorobium phaeobacteroides BS1, another green sulfur bacterium adapted to extremely low light, demonstrates exceptionally low maintenance energy requirements (1.6–4.9·10-15 kJ cell-1 day-1) . nuoA1 in Chloroherpeton thalassium may similarly be optimized for minimal energy expenditure during protein turnover while maintaining functional efficiency.

  • Coordination with specialized photosynthetic apparatus: The chlorosome-based light-harvesting system of Chloroherpeton thalassium, containing bacteriochlorophyll c , requires appropriate energy coupling through the electron transport chain components including nuoA1 to effectively utilize the limited photons available in deep water environments.

How might nuoA1 interact with other components of the photosynthetic apparatus?

The integration of nuoA1 with the photosynthetic machinery likely involves:

  • Interaction with quinone pool: nuoA1, as part of Complex I, would interact with the quinone pool that serves as an electron carrier between different components of the photosynthetic electron transport chain.

  • Chlorosome coordination: The characteristic chlorosomes of Chloroherpeton thalassium contain bacteriochlorophyll c as the main light-harvesting pigment , and the electron flow from these structures must ultimately connect with the proton-pumping machinery including nuoA1.

  • Sulfide oxidation integration: Since Chloroherpeton thalassium requires sulfide for growth , the electrons derived from sulfide oxidation (possibly via SQR-like enzymes) would enter the electron transport chain and potentially influence nuoA1 activity.

  • Membrane localization: As a membrane protein, nuoA1 would be positioned within the cytoplasmic membrane alongside other components of the photosynthetic apparatus. Some green sulfur bacteria display unique membrane arrangements to optimize light capture and energy transduction.

What approaches can be used to generate site-directed mutations in nuoA1 for structure-function studies?

For site-directed mutagenesis of nuoA1, researchers should consider:

  • Recombinant expression systems: Establishing a reliable heterologous expression system is prerequisite. E. coli-based expression using vectors containing T7 or similar strong, inducible promoters provides a platform for mutagenesis studies.

  • Mutagenesis strategies:

    • QuikChange PCR-based methods for single amino acid substitutions

    • Gibson Assembly for creating larger insertions or chimeric constructs

    • Golden Gate Assembly for systematic multiple-site mutations

  • Target selection rationale:

    • Conserved charged residues (Asp, Glu, Lys, Arg) in transmembrane regions as potential proton translocation sites

    • Interface residues predicted to interact with other Complex I subunits

    • Quinone-binding pocket residues identified through homology modeling

  • Validation approaches:

    • Complementation studies in appropriate knockout systems

    • In vitro activity assays with purified mutant proteins

    • Structural characterization (e.g., HDX-MS) to assess conformational impacts

When designing mutations, researchers should consider the membrane-embedded nature of nuoA1 and its likely role in proton translocation, focusing on charged residues within transmembrane segments that might participate in proton channels.

What genetic tools are available for studying nuoA1 in the native Chloroherpeton thalassium?

Genetic manipulation of Chloroherpeton thalassium presents significant challenges due to limited established tools for this organism. Researchers might consider:

  • Homologous recombination approaches: Similar to those developed for Chlorobaculum tepidum, which allowed targeted mutations of SQR homologs . This typically involves:

    • Construction of vectors containing nuoA1 flanking regions

    • Introduction of antibiotic resistance markers

    • Natural transformation or electroporation protocols adapted for Chloroherpeton thalassium

  • CRISPR-Cas9 based methods: While not specifically reported for Chloroherpeton thalassium, CRISPR systems have been adapted for related phototrophic bacteria and could potentially be optimized for this organism.

  • Reporter gene fusions: Constructing transcriptional or translational fusions with fluorescent proteins or enzymatic reporters can help monitor nuoA1 expression patterns in response to environmental conditions.

  • Conditional expression systems: Developing inducible promoter systems appropriate for Chloroherpeton thalassium would enable controlled expression of wild-type or mutant nuoA1 variants.

  • Epitope tagging: Similar to the successful C-terminal His6-tagging approach used for CT1087 in Chlorobaculum tepidum , epitope tags could be introduced to nuoA1 to facilitate detection and purification.

How can comparative genomics inform nuoA1 mutagenesis strategies?

Comparative genomics provides valuable insights for targeted mutagenesis of nuoA1:

  • Identification of conserved residues: Alignment of nuoA1 sequences across diverse green sulfur bacteria and related phototrophs reveals evolutionarily conserved residues likely essential for function.

  • Unique adaptations in Chloroherpeton thalassium: Residues unique to Chloroherpeton thalassium compared to freshwater relatives may represent adaptations to the marine environment and should be prioritized for mutagenesis.

  • Co-evolution analysis: Identifying residues that show correlated evolutionary patterns may reveal functionally linked networks within nuoA1 or between nuoA1 and other subunits.

  • Domain architecture comparison: Structural predictions based on related proteins with known structures can guide the selection of residues likely involved in quinone binding or proton translocation.

  • Paralogs analysis: If multiple nuoA variants exist in Chloroherpeton thalassium (as suggested by the "A1" designation), comparing these paralogs can reveal specialization patterns similar to those observed for SQR homologs in Chlorobaculum tepidum .

What are the critical factors for successful cultivation of Chloroherpeton thalassium for nuoA1 studies?

Successful cultivation requires careful attention to several factors:

  • Growth medium: ATCC Medium #616 is recommended for Chloroherpeton thalassium cultivation . This medium needs to be prepared with precise concentrations of marine salts and sulfide to support growth.

  • Light conditions: Incubation under 2000-4000 LUX light (positioned within 2-3 inches of a 15-watt fluorescent light) is optimal . The spectrum of light provided is important, with green sulfur bacteria typically preferring longer wavelengths that penetrate to their deep-water habitats.

  • Temperature control: Maintain cultures at 26°C for optimal growth .

  • Gas exchange: Incubating test tubes in a slanted position enhances gas exchange in broth cultures and improves exposure to light .

  • Anaerobic conditions: As an obligate anaerobe, Chloroherpeton thalassium requires strict exclusion of oxygen during all cultivation steps.

  • Sulfide concentration: Regular monitoring and maintenance of appropriate sulfide levels is essential, as it serves both as an electron donor and a reducing agent to maintain anaerobiosis.

  • Slow growth consideration: Green sulfur bacteria adapted to low-light environments typically exhibit slow growth rates, requiring extended incubation periods and patience during cultivation.

What are the best approaches for tracking the expression and localization of nuoA1 in Chloroherpeton thalassium?

For tracking nuoA1 expression and localization, researchers should consider:

  • Antibody-based detection: Development of specific antibodies against nuoA1 enables:

    • Western blot analysis of expression levels under different conditions

    • Immunofluorescence microscopy for cellular localization

    • Immunoprecipitation for interaction studies

  • Epitope tagging strategies: Similar to the approach used for CT1087 in Chlorobaculum tepidum , adding epitope tags (His6, FLAG, etc.) to nuoA1 facilitates detection while minimizing interference with function.

  • Transcript analysis: RT-qPCR or RNA-Seq approaches can quantify nuoA1 transcript levels in response to environmental variables like light intensity or sulfide concentration.

  • Membrane fractionation: Differential centrifugation and sucrose gradient separation of membrane fractions can confirm the expected membrane localization of nuoA1 and identify specific membrane domains where it concentrates.

  • Reporter fusion constructs: Where genetic manipulation is possible, creating transcriptional or translational fusions with fluorescent proteins can provide real-time monitoring of expression and localization.

  • Mass spectrometry: Proteomics approaches including targeted MS/MS can quantify nuoA1 abundance in membrane preparations from cultures grown under different conditions.

How can researchers overcome stability issues when working with recombinant nuoA1?

Membrane proteins like nuoA1 present significant stability challenges. Strategies to address these include:

  • Detergent optimization:

    • Systematic screening of detergent types (maltoside, glucoside, fos-choline series)

    • Testing detergent concentrations (typically 1-5× critical micelle concentration)

    • Exploring detergent mixtures that may better mimic the native membrane environment

  • Lipid supplementation:

    • Addition of specific lipids from Chloroherpeton thalassium membranes

    • Testing lipid-to-protein ratios (typically 0.5-2:1 w/w)

    • Reconstitution into nanodiscs or liposomes for enhanced stability

  • Buffer optimization:

    • Screening pH ranges (typically pH 6.5-8.0)

    • Testing various salt types and concentrations (50-500 mM)

    • Including stabilizing agents (glycerol 10-20%, sucrose 5-15%)

  • Protein engineering approaches:

    • Identifying and removing flexible termini that may promote aggregation

    • Introduction of thermostabilizing mutations identified through computational prediction

    • Creation of fusion constructs with well-folding soluble proteins

  • Storage considerations:

    • Flash-freezing in liquid nitrogen with cryoprotectants

    • Storage in the vapor phase rather than submerged in liquid nitrogen to prevent vial damage

    • Aliquoting to avoid freeze-thaw cycles

How can nuoA1 studies contribute to our understanding of extremophile adaptations?

Research on Chloroherpeton thalassium nuoA1 provides valuable insights into extremophile adaptations:

  • Low-light adaptation mechanisms: Green sulfur bacteria represent some of the most extreme low-light adapted phototrophs, capable of growth at intensities as low as 0.015 μmol photons m−2 s−1 . Understanding how nuoA1 contributes to energy conservation under these conditions illuminates fundamental principles of bioenergetic efficiency.

  • Marine sulfide interface adaptation: As a marine organism living at interfaces where both light and sulfide are available, Chloroherpeton thalassium has evolved specialized adaptations in its electron transport chain components, including nuoA1, to function optimally in this niche.

  • Oxygen tolerance mechanisms: Although obligately anaerobic, green sulfur bacteria must occasionally contend with oxygen exposure at interface zones. How nuoA1 and associated components maintain function or recover from oxidative damage provides insights into stress response mechanisms.

  • Energy minimization strategies: The extremely low maintenance energy requirements observed in related green sulfur bacteria suggest specialized adaptations in energy-transducing complexes like those containing nuoA1, potentially revealing novel principles for minimal energy systems.

  • Comparative genomic context: Analyzing the genomic neighborhood of nuoA1 in Chloroherpeton thalassium compared to other green sulfur bacteria can reveal co-evolved systems that contribute to environmental adaptation.

What potential biotechnological applications might emerge from nuoA1 research?

Chloroherpeton thalassium nuoA1 research may contribute to several biotechnological applications:

  • Bioenergy applications:

    • Development of highly efficient light-harvesting systems inspired by the energy conservation mechanisms of green sulfur bacteria

    • Engineering of artificial photosynthetic systems incorporating principles from nuoA1's role in energy coupling

    • Design of biohybrid systems for solar energy conversion with minimal energy losses

  • Biosensor development:

    • Creation of sulfide biosensors based on the sulfide-responsive elements of the electron transport chain

    • Development of low-light detection systems drawing inspiration from the excitation energy coupling mechanisms

  • Bioremediation technologies:

    • Engineered systems for sulfide removal from contaminated environments based on the sulfide oxidation machinery

    • Development of organisms with enhanced capacity for metal reduction or oxidation by engineering electron transport chain components

  • Protein engineering platforms:

    • Identification of protein motifs from nuoA1 that confer exceptional stability under challenging conditions

    • Development of membrane protein expression and stabilization technologies based on lessons from nuoA1

  • Novel antibiotics targets:

    • Understanding unique aspects of bacterial respiratory chains can reveal targets for new antimicrobials

    • Identification of essential residues in respiratory complexes could guide development of inhibitors specific to pathogenic species

What are the most promising directions for future nuoA1 research?

Future research on Chloroherpeton thalassium nuoA1 should consider:

  • Structural biology:

    • High-resolution structural determination through cryo-EM or X-ray crystallography

    • Comparative structural analysis with nuoA homologs from other bacteria

    • Dynamic structural studies examining conformational changes during the catalytic cycle

  • Systems biology approaches:

    • Integration of transcriptomics, proteomics, and metabolomics to understand how nuoA1 functions within the broader cellular context

    • Network analysis of protein-protein interactions involving nuoA1

    • Development of kinetic models of electron transport incorporating nuoA1 function

  • Evolutionary studies:

    • Detailed phylogenetic analysis of nuoA1 across diverse bacterial lineages

    • Identification of selective pressures shaping nuoA1 evolution in marine versus freshwater environments

    • Examination of horizontal gene transfer events involving nuoA1 and surrounding genomic regions

  • Synthetic biology applications:

    • Construction of minimal electron transport chains incorporating nuoA1

    • Engineering of hybrid systems combining components from different photosynthetic bacteria

    • Development of tunable expression systems for nuoA1 to modulate energy production

  • Ecological context:

    • Field studies examining nuoA1 expression in natural populations of Chloroherpeton thalassium

    • Investigation of how environmental parameters influence nuoA1 function in situ

    • Metagenomic analysis to identify novel nuoA1 variants in uncultured green sulfur bacteria

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.