Recombinant Chloroherpeton thalassium NADH-quinone oxidoreductase subunit A 2 (nuoA2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA2; Ctha_2565; NADH-quinone oxidoreductase subunit A 2; NADH dehydrogenase I subunit A 2; NDH-1 subunit A 2; NUO1 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-152
Protein Length
full length protein
Species
Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Target Names
nuoA2
Target Protein Sequence
MDYTISEFGKVFLFLLFGVVFVIGGYVSSRMLRPHRPNDEKLTSYECGEEAVGSAWVQFN IRFYVVALIFIIFDVEVLFLFPWATVFKQLGGFALFEAVIFVTILTLGLVYAWVKGDLDW VRPTPNVPKMPEKRFDNISSGRSQVVKEESVS
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, the primary electron acceptor is believed to be a menaquinone. This redox reaction is coupled to proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thus harnessing redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chloroherpeton thalassium NADH-quinone oxidoreductase subunit A 2 (nuoA2)?

NADH-quinone oxidoreductase subunit A 2 (nuoA2) is a protein component of the respiratory chain complex I in Chloroherpeton thalassium, a green sulfur bacterium from the phylum Chlorobi. The protein consists of 152 amino acids and functions as part of the membrane domain of the NADH dehydrogenase complex. This complex plays a critical role in electron transport and energy metabolism in these phototrophic bacteria, which are adapted to low-light, sulfide-rich environments . The gene is also identified by the locus tag Ctha_2565 and has several synonyms including NADH dehydrogenase I subunit A 2 and NDH-1 subunit A 2 .

How does nuoA2 function in the context of photosynthetic bacteria?

Within Chloroherpeton thalassium, nuoA2 operates as part of the NADH-quinone oxidoreductase complex (Complex I) in the electron transport chain. These green sulfur bacteria are phototrophic organisms adapted to environments with simultaneous presence of light and sulfide, typically in deeper water layers where light intensity is reduced to 0.02-10% of surface values . The electron transport chain components, including nuoA2, are critical for energy generation in these bacteria under low-light conditions, allowing them to occupy ecological niches below oxygenic phototrophs in stratified water bodies .

What expression systems are optimal for producing recombinant nuoA2?

E. coli is the predominant expression system used for recombinant production of Chloroherpeton thalassium nuoA2 protein . When designing expression protocols, researchers should consider:

  • Codon optimization for E. coli expression

  • Selection of appropriate vector systems compatible with hydrophobic membrane proteins

  • Induction conditions that balance protein yield with proper folding

  • Fusion tags (commonly His-tag) positioned at the N-terminus to facilitate purification

Alternative expression systems including yeast, baculovirus, or mammalian cell lines may be considered for applications requiring specific post-translational modifications or when E. coli expression yields poor results .

What are the recommended storage and handling protocols for purified nuoA2?

For optimal stability and activity of purified recombinant nuoA2 protein:

  • Store long-term at -20°C or -80°C in buffer containing glycerol (typically with 50% final concentration)

  • Prepare working aliquots to be stored at 4°C for up to one week to avoid freeze-thaw cycles

  • When reconstituting lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Consider adding 5-50% glycerol to reconstituted protein for stability

  • Briefly centrifuge vials before opening to ensure contents are at the bottom

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

The protein is typically stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability .

What purification strategies yield highest purity recombinant nuoA2?

To achieve >90% purity for recombinant nuoA2, a multi-step purification approach is recommended:

  • Primary capture: Immobilized metal affinity chromatography (IMAC) utilizing the N-terminal His-tag

  • Intermediate purification: Ion exchange chromatography to separate based on charge properties

  • Polishing step: Size exclusion chromatography to remove aggregates and obtain homogeneous protein

For membrane proteins like nuoA2, consider including detergents in purification buffers to maintain protein solubility. Common detergents include n-dodecyl β-D-maltoside (DDM) or digitonin at concentrations above their critical micelle concentration. Purity should be assessed using SDS-PAGE, with commercial preparations typically achieving >90% purity .

How can researchers investigate nuoA2's role in bacterial adaptation to low-light environments?

Investigating nuoA2's role in adaptation to low-light environments requires a multi-faceted approach:

  • Comparative genomics: Analyze nuoA2 sequence variations between Chloroherpeton thalassium and other green sulfur bacteria adapted to different light intensities. This approach could identify conserved versus variable regions that correlate with light adaptation capabilities .

  • Transcriptomics: Measure nuoA2 expression levels under varying light conditions (similar to studies done with Chlorobium phaeobacteroides BS1, which showed differential regulation of energy metabolism genes under low light) .

  • Mutagenesis experiments: Create site-directed mutants of key residues in nuoA2 to test their impact on electron transport efficiency under varying light intensities.

  • Structural biology: Employ cryo-EM or X-ray crystallography of the full NADH-quinone oxidoreductase complex containing nuoA2 to understand structural adaptations that might enhance energy capture efficiency.

  • In vitro reconstitution: Reconstruct partial or complete electron transport chains incorporating wild-type or mutant nuoA2 to measure electron transfer rates under different conditions .

What methodological approaches are effective for studying interactions between nuoA2 and other subunits of the NADH-quinone oxidoreductase complex?

To investigate protein-protein interactions involving nuoA2 within the NADH-quinone oxidoreductase complex:

  • Co-immunoprecipitation: Using antibodies specific to nuoA2 or its tagged version to pull down interaction partners.

  • Cross-linking mass spectrometry: Apply chemical cross-linkers followed by MS/MS analysis to identify residues in close proximity between nuoA2 and other subunits.

  • Bacterial two-hybrid systems: Adapted for membrane proteins to detect interactions between nuoA2 and other complex components.

  • FRET-based approaches: Using fluorescently tagged subunits to measure proximity and dynamics of interactions in reconstituted systems.

  • Molecular modeling: Combine available structural data from related organisms with sequence information to predict interaction interfaces.

  • Reconstitution experiments: Systematically incorporate or omit specific subunits to determine their impact on complex assembly and function .

How does nuoA2 compare functionally with its homologs in other photosynthetic bacteria?

Functional comparison of nuoA2 with homologs requires:

  • Phylogenetic analysis: Construct evolutionary trees of nuoA2 sequences across diverse photosynthetic bacteria to identify clades with potential functional specialization.

  • Comparative biochemistry: Express and purify homologous proteins from different bacterial species to compare:

    • Enzyme kinetics

    • Substrate specificity

    • pH and temperature optima

    • Electron transfer rates

  • Complementation studies: Express nuoA2 from Chloroherpeton thalassium in mutant strains of other bacteria lacking their native subunit to assess functional conservation.

  • Spectroscopic analysis: Compare spectral properties of complexes containing different nuoA2 homologs to identify differences in electron transfer capabilities or cofactor interactions .

  • Environmental correlation: Analyze the relationship between nuoA2 sequence variations and the ecological niches occupied by different photosynthetic bacteria, particularly regarding light intensity and sulfide availability .

What are common challenges in expressing and purifying functional nuoA2, and how can they be addressed?

Researchers frequently encounter these challenges when working with nuoA2:

ChallengePossible CausesSolutions
Low expression yieldToxicity to host cells; protein instabilityUse tightly regulated induction systems; lower induction temperature (16-20°C); try specialized E. coli strains (C41/C43) designed for membrane proteins
Protein aggregationImproper folding; hydrophobic interactionsInclude appropriate detergents in lysis and purification buffers; optimize detergent type and concentration; consider fusion partners that enhance solubility
Loss of activity during purificationRemoval of essential lipids or cofactorsInclude lipid supplements during purification; maintain reducing conditions if appropriate; minimize time between cell lysis and final storage
Incomplete purificationNon-specific binding to purification resinOptimize imidazole concentrations in binding and washing buffers; consider dual tagging approaches; include additional purification steps
Poor stability after purificationBuffer incompatibility; oxidationScreen different buffer conditions with thermal shift assays; include stabilizing agents like glycerol or trehalose; maintain at 4°C for short-term use

How can researchers assess the functional integrity of purified recombinant nuoA2?

To confirm proper folding and functionality of purified nuoA2:

  • Circular dichroism (CD) spectroscopy: Analyze secondary structure content to verify proper folding.

  • NADH dehydrogenase activity assays: While nuoA2 alone may not have catalytic activity, it could be reconstituted with other subunits to measure electron transfer from NADH to artificial electron acceptors.

  • Thermal shift assays: Assess protein stability and folding in different buffer conditions.

  • Limited proteolysis: Properly folded proteins typically show distinct proteolytic patterns compared to misfolded variants.

  • Incorporation into liposomes: Test the ability of nuoA2 to properly integrate into artificial membrane systems.

  • Complex assembly assays: Verify the capacity of nuoA2 to associate with partner subunits of the NADH-quinone oxidoreductase complex .

What insights might nuoA2 research provide for understanding bacterial adaptation to extreme environments?

Research on nuoA2 from Chloroherpeton thalassium can provide valuable insights into bacterial adaptation to extreme environments, particularly low-light, sulfide-rich habitats:

  • Energy efficiency mechanisms: Understanding how the NADH-quinone oxidoreductase complex containing nuoA2 maintains efficient energy metabolism under limited light conditions could reveal novel adaptations for energy conservation .

  • Electron transport specialization: Analysis of nuoA2's structure and function might reveal specific adaptations that optimize electron transport under low-energy conditions typical of deep water environments where phototrophic sulfur bacteria thrive .

  • Evolutionary adaptations: Comparative studies of nuoA2 across different species can illuminate evolutionary pathways that led to specialization for specific environmental niches, particularly at the molecular level of respiratory chain components .

  • Stress response integration: Investigating how nuoA2-containing complexes respond to changing environmental conditions could provide insights into the integration of stress response mechanisms with core metabolic processes .

  • Ecological niche differentiation: Understanding the functional properties of nuoA2 can help explain how different species of phototrophic bacteria can coexist in stratified environments by utilizing different wavelengths of light and maintaining distinct positions in the water column .

What emerging techniques might enhance our understanding of nuoA2 structure and function?

Several cutting-edge methodologies could advance nuoA2 research:

  • Cryo-electron microscopy: High-resolution structures of membrane protein complexes including nuoA2 can now be determined, potentially revealing unique structural adaptations.

  • Native mass spectrometry: Characterizing intact membrane protein complexes containing nuoA2 to understand subunit stoichiometry and interactions.

  • Single-molecule FRET: Investigating dynamic conformational changes in nuoA2 during the catalytic cycle of the NADH-quinone oxidoreductase complex.

  • In-cell NMR: Studying the structure and dynamics of nuoA2 in its native cellular environment.

  • AlphaFold and related AI approaches: Generating highly accurate structural predictions of nuoA2 and its interactions with other subunits.

  • CRISPR-based genome editing: Creating precise modifications in the nuoA2 gene within Chloroherpeton thalassium to study function in the native organism.

  • Environmental metatranscriptomics: Analyzing nuoA2 expression patterns in natural habitats to understand its regulation under authentic environmental conditions .

What are the key considerations for designing robust experiments involving nuoA2?

When designing experiments with recombinant Chloroherpeton thalassium nuoA2, researchers should consider:

  • Protein stability: Include appropriate detergents and stabilizing agents throughout purification and storage; minimize freeze-thaw cycles .

  • Functional context: Remember that nuoA2 is part of a multi-subunit complex—studies of the isolated subunit should be interpreted cautiously.

  • Membrane environment: Consider reconstitution into liposomes or nanodiscs to provide a native-like membrane environment for functional studies.

  • Environmental parameters: Include experimental conditions that reflect the natural habitat of Chloroherpeton thalassium, such as low light intensity and the presence of sulfide .

  • Controls and standards: Include appropriate positive and negative controls, particularly when comparing nuoA2 with homologs from other species.

  • Experimental validation: Employ multiple complementary techniques to verify findings, especially for structural or interaction studies.

  • Ecological relevance: Connect molecular findings to ecological context to understand the adaptive significance of observations about nuoA2 function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.