Recombinant Chloroherpeton thalassium NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Ctha_2484; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Target Names
nuoK
Target Protein Sequence
MEIELGHYLALSAFVFICGVLGVLTRRNAIIIFMSIELMLNAVNLSFVAFSHYLSDIAGQ MMVFFVMTVAAAEAAVGLAIVISLFRNKQTVNIDEINLLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be a menaquinone. The enzyme couples the redox reaction to proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chloroherpeton thalassium and how does it differ from other green sulfur bacteria?

Chloroherpeton thalassium is a green sulfur bacterium that serves as an important phylogenetic branch point within the green sulfur bacteria (GSB) family. Unlike most other GSB, C. thalassium has retained the complete set of 14 subunits in its type I NADH dehydrogenase complex, while other GSB species have evolutionarily lost three subunits: NuoE, NuoF, and NuoG, which are involved in NADH binding and oxidation . This key difference emerged after the divergence of Chloroherpeton spp. from other GSB lineages, as phylogenetic analysis indicates that both Chloroherpeton thalassium and the earlier diverging Ignavibacterium album possess all 14 subunits . This retention of the complete NADH dehydrogenase complex likely represents a major physiological adaptation that impacts the organism's oxidative sulfur metabolism and energy conservation strategies compared to other GSB members.

What is the function of NADH-quinone oxidoreductase in bacterial energy metabolism?

NADH-quinone oxidoreductase (NDH-1) functions as a critical enzyme in bacterial energy metabolism, coupling the oxidation of NADH to the reduction of menaquinone or other isoprenoid quinones, depending on the specific bacterial species . This electron transfer process is directly coupled to proton pumping across the cytoplasmic membrane, contributing to the establishment of the proton motive force that drives ATP synthesis .

The bacterial H+-translocating NADH:quinone oxidoreductase (NDH-1) contains multiple subunits organized into two major domains: a peripheral arm involved in electron transfer from NADH, and a membrane domain containing hydrophobic subunits that participate in proton translocation . In most bacteria, this enzyme serves as the primary entry point for electrons into the respiratory chain, making it essential for energy conservation during aerobic and anaerobic respiration.

What expression systems are most effective for producing functional recombinant NuoK from Chloroherpeton thalassium?

For recombinant expression of membrane proteins like NuoK from Chloroherpeton thalassium, several expression systems can be employed with varying advantages:

  • E. coli-based expression systems: For hydrophobic membrane proteins like NuoK, specialized E. coli strains such as C41(DE3) or C43(DE3) often yield better results than standard BL21(DE3) strains. These strains are designed specifically for toxic or membrane protein expression.

  • Cell-free expression systems: These can be advantageous for transmembrane proteins as they avoid toxicity issues associated with membrane protein overexpression in living cells. The addition of lipids or detergents to the reaction mixture can facilitate proper folding.

  • Experimental conditions optimization:

    ParameterRecommended RangeNotes
    Induction temperature16-25°CLower temperatures reduce aggregation
    IPTG concentration0.1-0.5 mMLower concentrations promote proper folding
    Expression time4-16 hoursExtended time at lower temperatures
    Media supplements1% glucose, 1-5% ethanolCan enhance membrane protein expression

When working with C. thalassium proteins, it's critical to consider codon optimization for the expression host, as green sulfur bacteria have different codon usage patterns than common expression hosts. Additionally, fusion tags (such as His6, MBP, or SUMO) can improve solubility and facilitate purification, though care must be taken as tags may interfere with the transmembrane topology of NuoK.

What culture conditions should be used when working with Chloroherpeton thalassium for native protein extraction?

When cultivating Chloroherpeton thalassium for native protein extraction, precise culture conditions are essential to obtain healthy cells with properly expressed NuoK:

  • The organism should be cultured in ATCC Medium #616 broth at 26°C under specific light conditions (2000-4000 LUX, positioned within 2-3 inches of a 15-watt fluorescent light) .

  • For optimal gas exchange and light exposure, tubes should be incubated in a slanted position, which enhances both aerobic conditions in the broth and exposure to light .

  • Proper biosafety protocols must be followed when handling C. thalassium cultures, with appropriate personal protective equipment used at all times as recommended by the ATCC and Biosafety in Microbiological and Biomedical Laboratories (BMBL) guidelines .

  • For storage of cultures, the vapor phase of liquid nitrogen is preferred over submersion in liquid nitrogen to prevent potential hazards associated with vial explosion during thawing .

Native protein extraction should be performed at mid-to-late logarithmic growth phase to maximize protein yield while ensuring proper protein folding and assembly into the membrane.

What methods are most effective for assaying NADH-quinone oxidoreductase activity in recombinant systems?

Several effective methodological approaches can be used to assess the activity of recombinant NADH-quinone oxidoreductase containing NuoK:

  • NADH oxidation assay: Monitoring the decrease in absorbance at 340 nm due to NADH oxidation in the presence of appropriate quinone acceptors (such as ubiquinone-1 or decylubiquinone for heterologous systems).

  • Proton pumping measurements: Using pH-sensitive fluorescent dyes (like ACMA or pyranine) in reconstituted proteoliposomes to assess proton translocation activity coupled to NADH oxidation.

  • Oxygen consumption assays: For aerobic systems, measuring oxygen consumption using a Clark-type electrode when NADH is supplied as substrate.

  • Spectral analysis of electron transfer: Monitoring changes in the redox state of iron-sulfur clusters and other prosthetic groups during enzyme turnover using UV-visible or EPR spectroscopy.

For experimental design, it's crucial to include appropriate controls:

ControlPurpose
Enzyme without substrateBackground activity measurement
Heat-inactivated enzymeNon-enzymatic reaction rates
Specific inhibitors (rotenone, piericidin A)Confirmation of specific NDH-1 activity
Wild-type vs. mutant variantsStructure-function relationship assessment

What role do the conserved glutamic acid residues in NuoK play in NADH-quinone oxidoreductase function?

The conserved glutamic acid residues in the NuoK subunit play critical roles in the energy transduction mechanism of NADH-quinone oxidoreductase:

  • Essential for catalytic activity: The highly conserved glutamic acid residue (K)Glu-36 located in the second transmembrane helix (TM2) is absolutely essential for enzyme function. Mutation of this residue to alanine results in complete loss of NDH-1 activities . This suggests that this residue likely participates directly in proton translocation or in maintaining a conformation necessary for energy coupling.

  • Proton transfer pathway: The carboxyl groups of these conserved glutamic acid residues are thought to form part of the proton transfer pathway across the membrane. Their strategic positioning in adjacent transmembrane helices facilitates proton movement through the membrane domain of the enzyme.

  • Conformational coupling: These residues may also participate in the conformational changes that couple electron transfer in the peripheral arm to proton translocation in the membrane domain. The negative charge of the carboxyl groups can form dynamic electrostatic interactions that respond to the redox state of the complex.

The conservation of these residues across diverse species underscores their functional importance. In experimental designs targeting these residues, site-directed mutagenesis to create variants with conservative (Glu to Asp) and non-conservative (Glu to Ala or Gln) substitutions can provide insights into the precise requirements for charge, hydrogen bonding capability, and side chain length at these positions.

How can we determine the membrane topology of NuoK in Chloroherpeton thalassium?

Multiple complementary approaches can be employed to accurately determine the membrane topology of NuoK:

For Chloroherpeton thalassium NuoK specifically, comparing its predicted topology with experimentally determined structures of homologous subunits from other organisms can provide insights into its likely arrangement, while recognizing that there may be species-specific differences that affect function and assembly.

How can protein-protein interactions between NuoK and other NADH-quinone oxidoreductase subunits be characterized?

Several methodological approaches can be employed to characterize the protein-protein interactions between NuoK and other subunits of the NADH-quinone oxidoreductase complex:

  • Chemical crosslinking coupled with mass spectrometry:

    • Use bifunctional crosslinking reagents with different spacer arm lengths to capture transient interactions

    • Follow with protease digestion and mass spectrometric analysis to identify crosslinked peptides

    • This approach can identify specific residues involved in subunit interfaces

  • Co-immunoprecipitation and pull-down assays:

    • Generate antibodies against NuoK or use epitope-tagged versions

    • Perform pull-downs followed by immunoblotting or mass spectrometry to identify interacting partners

    • Varying detergent conditions can reveal different interaction strengths

  • FRET (Förster Resonance Energy Transfer):

    • Label NuoK and potential partner subunits with fluorescent donor-acceptor pairs

    • Measure energy transfer as an indication of proximity (typically <10 nm)

    • Can be performed in membrane preparations or reconstituted systems

  • Bacterial two-hybrid or split-protein complementation systems:

    • Adapt these yeast-based methods for membrane proteins by using appropriate membrane-associated reporter systems

    • Can be used to screen for interactions or confirm specific suspected interactions

  • Site-directed mutagenesis combined with functional assays:

    • Systematically mutate residues predicted to be at interfaces

    • Assess effects on complex assembly and function

    • Particularly valuable for determining which interactions are functionally important

    Interaction Analysis MethodAdvantagesLimitations
    Chemical crosslinking/MSCan capture transient interactions, identifies specific contact pointsPotential for artifacts, requires specialized equipment
    Co-immunoprecipitationRelatively simple, works for native complexesMay disrupt weak interactions, background binding
    FRETWorks in intact membranes, provides distance informationRequires fluorescent labeling, potential interference
    Bacterial two-hybridCan detect binary interactionsMay miss interactions dependent on larger complex
    Mutagenesis/functionDirectly links interaction to functionLabor intensive, indirect evidence

For NuoK specifically, it's important to focus on interactions with other membrane subunits that may form part of the proton translocation pathway, as these interactions are likely critical for the coordinated function of the enzyme complex.

What are the evolutionary implications of Chloroherpeton thalassium retaining all 14 subunits of NADH dehydrogenase while other green sulfur bacteria have lost three subunits?

The retention of all 14 subunits of NADH dehydrogenase (including NuoE, NuoF, and NuoG) in Chloroherpeton thalassium, in contrast to their absence in later-diverging green sulfur bacteria (GSB), has significant evolutionary and functional implications:

  • Phylogenetic placement: This retention pattern supports C. thalassium's position as an early-branching member of the GSB lineage, as both C. thalassium and the earlier-diverging Ignavibacterium album retain the complete set of subunits . This provides a molecular marker for evolutionary relationships within these bacterial groups.

  • Functional differences in NADH oxidation: Since NuoE, NuoF, and NuoG function in binding and oxidation of NADH, their presence in C. thalassium likely indicates that this organism has maintained the ancestral mechanism for direct NADH oxidation . In contrast, other GSB have potentially evolved alternative electron input mechanisms to their NADH dehydrogenase complexes.

  • Metabolic consequences: This structural difference likely represents a major physiological distinction between Chloroherpeton spp. and other GSB, potentially affecting:

    • Substrate utilization capabilities

    • Electron transfer efficiency

    • Energy conservation strategies

    • Adaptation to specific ecological niches

  • Evolutionary selection pressures: The loss of these subunits in other GSB suggests that:

    • There may have been a selective advantage to losing these subunits in certain environments

    • Alternative electron donors may have become more important in the metabolic strategies of later-diverging GSB

    • Genome streamlining may have occurred in response to particular ecological pressures

This evolutionary pattern provides a valuable window into the adaptive changes in respiratory chain composition during the diversification of green sulfur bacteria, with C. thalassium representing a more ancestral state of the NADH dehydrogenase complex.

How does the structure and function of NuoK in Chloroherpeton thalassium compare to homologous subunits in other organisms?

The NuoK subunit in Chloroherpeton thalassium shares fundamental structural and functional features with homologous subunits in other organisms, while also exhibiting distinctive characteristics:

Understanding these similarities and differences provides valuable insights into both the conserved core functions of this subunit in bioenergetic systems and the specific adaptations that have occurred in different lineages.

What experimental designs can help elucidate how the complete NADH dehydrogenase complex in Chloroherpeton thalassium affects its metabolic capabilities?

To investigate how the complete NADH dehydrogenase complex affects the metabolic capabilities of Chloroherpeton thalassium compared to other green sulfur bacteria, several experimental approaches can be employed:

  • Comparative growth studies:

    • Design experiments comparing growth rates and yields of C. thalassium versus other GSB under varying electron donor conditions

    • Test growth with different NADH-generating substrates to assess the functional significance of the complete complex

    • Measure growth parameters under conditions that would specifically engage the NuoE, NuoF, and NuoG subunits

  • Enzyme activity measurements:

    • Design experiments to assess NADH oxidation rates in membrane preparations from C. thalassium versus other GSB

    • Compare kinetic parameters (Km, Vmax) for NADH and alternative electron donors

    • Evaluate sensitivity to specific inhibitors that target different components of the electron transport chain

  • Genetic manipulation approaches:

    • Create deletion mutants of nuoE, nuoF, and nuoG in C. thalassium to mimic the natural state of other GSB

    • Complementation studies with these genes in other GSB species lacking them

    • Assess phenotypic consequences of these genetic modifications

    Experimental Design ElementVariables to ControlMeasurementsExpected Insights
    Growth medium compositionCarbon sources, electron donors/acceptors, nutrient levelsGrowth rate, yield, lag phase durationSubstrate utilization capabilities
    Oxygen level variationStrictly anaerobic to microaerobic conditionsOxygen consumption, growth parametersRespiratory flexibility
    Temperature and pH ranges5°C increments from 15-40°C, pH 5-9Enzyme activity, growth rateEnvironmental adaptations
    Starvation responseLimitation of key nutrientsMetabolite profiles, enzyme activitiesMetabolic prioritization
  • Metabolic flux analysis:

    • Use isotopically labeled substrates to trace carbon and electron flow through central metabolism

    • Compare flux distributions between C. thalassium and other GSB under identical conditions

    • Identify metabolic pathways differentially affected by the presence of the complete NADH dehydrogenase complex

  • Transcriptomic and proteomic profiling:

    • Compare global gene expression and protein abundance patterns between C. thalassium and other GSB

    • Identify regulatory networks associated with the complete versus truncated complex

    • Assess compensatory mechanisms that may exist in organisms lacking NuoE, NuoF, and NuoG

These experimental approaches should be designed following proper experimental design principles, including appropriate randomization, controls, and replication to ensure statistical validity of the results .

What are common challenges in expressing and purifying recombinant NuoK, and how can they be addressed?

Expressing and purifying membrane proteins like NuoK presents several challenges that can be addressed through specific methodological approaches:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test different promoter strengths and induction conditions

    • Consider fusion partners that enhance expression (MBP, SUMO, etc.)

    • Try specialized expression strains designed for membrane proteins

  • Protein misfolding and aggregation:

    • Lower induction temperature (16-20°C) to slow protein synthesis

    • Reduce inducer concentration

    • Co-express with chaperones

    • Add chemical chaperones to the growth medium (e.g., 4% ethanol, glycerol, or specific lipids)

  • Inefficient membrane insertion:

    • Ensure signal sequences are properly recognized by using host-compatible signals

    • Consider using in vitro translation systems with supplied membrane fractions

    • For bacterial expression, the use of C41/C43 E. coli strains can improve membrane protein yields

  • Extraction and solubilization difficulties:

    • Screen multiple detergents or detergent mixtures (DDM, LMNG, digitonin)

    • Try native nanodiscs or SMALPs (styrene-maleic acid lipid particles) for detergent-free extraction

    • Optimize detergent:protein ratios and solubilization conditions

    DetergentOptimal ConcentrationAdvantagesLimitations
    DDM0.5-1%Gentle, widely usedLarge micelles
    LMNG0.01-0.1%Stabilizing, small micellesExpensive
    Digitonin0.5-1%Preserves complexesNatural product variability
    CHAPS0.5-2%Good for preliminary screeningLimited stability
    SMA copolymer2-3%Detergent-free, native lipidspH limitations
  • Purification challenges:

    • Use two orthogonal purification steps (e.g., IMAC followed by size exclusion)

    • Include stabilizing agents throughout purification (glycerol, specific lipids)

    • Maintain critical ion concentrations (particularly Mg2+) during purification

    • Consider on-column detergent exchange to more stabilizing detergents

  • Instability during storage:

    • Add glycerol (10-20%) to storage buffers

    • Include small amounts of lipids in storage buffers

    • Test cryoprotectants such as sucrose or trehalose

    • For long-term storage, flash-freeze small aliquots and avoid freeze-thaw cycles

When working specifically with Chloroherpeton thalassium NuoK, additional consideration should be given to the organism's native growth temperature (26°C) , which suggests that protein stability may be optimized in the mesophilic range rather than at lower temperatures often used for thermophilic membrane proteins.

How can we troubleshoot issues with reconstituting functional NuoK into membrane systems for activity assays?

Reconstitution of NuoK into membrane systems for functional studies presents specific challenges that can be addressed through methodical troubleshooting:

  • Improper orientation in liposomes:

    • Use freeze-thaw cycles and/or extrusion to promote proper insertion

    • Consider asymmetric reconstitution methods that better control protein orientation

    • Verify orientation using proteolytic digestion of exposed domains or antibody accessibility

  • Poor incorporation efficiency:

    • Optimize lipid:protein ratios through systematic testing

    • Test different lipid compositions, including native lipid extracts from C. thalassium

    • Adjust detergent removal rates (dialysis speed, Bio-Bead addition rate)

    • Monitor incorporation using fluorescence or density gradient techniques

  • Loss of activity during reconstitution:

    • Include stabilizing factors throughout the process (specific ions, substrates)

    • Maintain appropriate pH and ionic strength conditions

    • Keep temperatures low during reconstitution

    • Minimize exposure to air for oxygen-sensitive components

  • Incomplete complex assembly:

    • For multi-subunit complexes, consider co-reconstitution of purified subunits

    • Alternatively, purify and reconstitute the intact complex rather than individual subunits

    • Verify complex integrity using blue native PAGE or analytical size exclusion chromatography

    Reconstitution MethodBest ForTechnical Considerations
    Detergent dialysisGentle reconstitutionSlow, requires multiple buffer changes
    Bio-Bead adsorptionControlled rate reconstitutionAllow stepwise addition, beads can bind protein
    Dilution methodQuick screeningOften lower incorporation efficiency
    Direct incorporation during liposome formationSmall hydrophobic proteinsCan result in mixed orientations
  • Assay sensitivity issues:

    • Increase protein:lipid ratios for better signal

    • Use more sensitive detection methods (fluorescence vs. absorbance)

    • Reduce background by extensive washing of proteoliposomes

    • Include appropriate ionophores as controls to distinguish specific activity

  • Functional coupling difficulties:

    • For NADH-quinone oxidoreductase, ensure all electron transport components are present

    • Test different quinone analogs for optimal electron acceptance

    • Add mitochondrial or bacterial F1FO ATP synthase to couple proton gradient to ATP synthesis for more sensitive detection

    • Use pH-sensitive fluorescent dyes (ACMA, pyranine) to directly monitor proton pumping

When working specifically with recombinant NuoK from Chloroherpeton thalassium, it's important to consider that the native lipid environment might have unique features related to the organism's habitat. The green sulfur bacterial membrane composition might require specific lipids or lipid mixtures for optimal functional reconstitution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.