Recombinant Chlorokybus atmophyticus Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-319
Protein Length
Full Length of Mature Protein
Species
Chlorokybus atmophyticus (Soil alga)
Target Names
petA
Target Protein Sequence
YPIFAQQAYENPREATGRIVCANCHLAKKSVDIEVPQAVLPNTVFEAVVKIPYDIQLKQV LANGKKGGLNVGAVLILPEGFQIAPADRIPEEMKSKIGNLYYQPYSAEKKNIVVVGPIPG KTYQEIVFPILSPDPAKDKGTHFFKYPIYVGGNRGRGQIYPDGSKSNNNVYNASTTGKII QITAKPKGGYILNIETPDGATIEEKIPAGPELIVSEGQSVKADQPLTKNPNVGGFGQTEG EIVLQNPARIQGLIAFFISVIIAQTFLVLKKKQFERVQLAEMNF
Uniprot No.

Target Background

Function
Recombinant Chlorokybus atmophyticus Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What techniques are effective for analyzing the CXXCH motif in apocytochrome f and its role in heme attachment?

To investigate the CXXCH motif (critical for heme attachment), researchers should employ a multi-faceted methodological approach:

  • Site-directed mutagenesis: Create variants with alterations to the cysteine residues in the CXXCH motif to assess their individual contributions to heme binding. Similar approaches with cytochrome f variants have demonstrated three-fold increases in synthesis rates .

  • Redox manipulation: Employ thiol-specific reducing agents (DTT) at varying concentrations to examine their impact on heme attachment. Studies have shown that DTT can partially rescue cytochrome assembly in mutants with defective assembly pathways .

  • Heterologous reconstitution systems: Express Chlorokybus atmophyticus apocytochrome f in E. coli strains engineered with different cytochrome assembly pathways (Systems I, II, or III) to compare maturation efficiency. For example:

    • System I: Co-express with CcmABCDEFGH proteins

    • System II: Co-express with CcsBA fusion protein

    • System III: Co-express with CCHL (cytochrome c heme lyase)

  • In vitro assembly assays: Combine purified apocytochrome f with heme and appropriate assembly factors under controlled redox conditions to monitor heme attachment kinetics and efficiency.

Assembly SystemComponentsRecognition SpecificityRedox Requirements
System I (CcmABCDEFGH)Eight proteins in periplasmModerateDsbC/DsbD pathway
System II (CcsBA)Fused membrane proteinLow (recognizes diverse CXXCH motifs)DsbC/DsbD pathway
System III (CCHL)Single proteinHigh (species-specific)Partial DsbC/DsbD dependence

These approaches can reveal crucial insights about the structure-function relationship of the CXXCH motif in cytochrome maturation .

What expression systems and conditions yield optimal results for recombinant Chlorokybus atmophyticus apocytochrome f production?

The primary expression system for Chlorokybus atmophyticus apocytochrome f is E. coli, though yeast systems have also been documented . When designing expression protocols, consider the following methodological parameters:

E. coli expression system optimization:

  • Vector selection: pET-series vectors with T7 promoter systems offer strong induction control

  • Host strain selection: BL21(DE3) derivatives lacking proteases enhance protein stability

  • Induction conditions: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) often improve solubility of membrane-associated proteins like apocytochrome f

  • Growth media: Enriched media (TB or 2XYT) supplemented with glucose can improve yield while minimizing basal expression

  • Co-expression with chaperones: Systems like GroEL/GroES can enhance proper folding

Yeast expression may offer advantages for proper folding of this eukaryotic protein. The recombinant protein specifications indicate successful production with the following characteristics :

ParameterSpecification
Expression HostE. coli or Yeast
TagN-terminal His
Protein LengthMature Protein (aa 36-319)
Purity>85-90% (SDS-PAGE)
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

What methodological approaches can enhance the solubility and stability of recombinant apocytochrome f during purification?

Purification of recombinant apocytochrome f presents challenges due to its membrane-associated nature. Implement these evidence-based methodological strategies:

  • Lysis optimization:

    • Use mild detergents (0.5-1% n-dodecyl β-D-maltoside or CHAPS) to solubilize membrane-associated proteins

    • Include protease inhibitors to prevent degradation

    • Perform lysis under reducing conditions (1-5 mM DTT or β-mercaptoethanol) to maintain cysteine residues in reduced state

  • Purification strategy:

    • Two-step chromatography: IMAC (Ni-NTA) followed by size exclusion chromatography

    • Monitor protein oxidation state during purification by non-reducing SDS-PAGE

    • Keep all buffers cold (4°C) and include stabilizing agents

  • Storage conditions:

    • Aliquot purified protein to avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • For long-term storage, add glycerol (final concentration 5-50%) and store at -20°C/-80°C

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

These approaches enhance protein stability and functionality for downstream applications in cytochrome assembly research.

How does Chlorokybus atmophyticus contribute to our understanding of photosynthetic evolution?

Chlorokybus atmophyticus represents one of the earliest diverging lineages of the Streptophyta, which includes all land plants and six groups of charophycean green algae . Its position is significant for several reasons:

  • Phylogenetic placement: Along with Mesostigma viride, Chlorokybus represents the most ancient lineage of the streptophyte clade, providing crucial insights into the ancestral state of the photosynthetic apparatus .

  • Genomic features: Chlorokybus possesses the largest mitochondrial genome among green algae (201,763 bp), which is 4.8-fold larger than its Mesostigma counterpart . This genome carries 70 conserved genes, accounting for 41.4% of the sequence, including nad10 and trnL(gag) - genes reported for the first time in a streptophyte mitochondrial DNA .

  • Genome architecture: The mitochondrial genome of Chlorokybus shows remarkable similarities to land plant mitochondrial genomes in terms of size, gene content, gene density, and abundance of repeats, resembling the mtDNA of the bryophyte Marchantia . This challenges previous concepts that mitochondrial genomes were constrained to remain compact during charophycean evolution and only expanded with land plant emergence .

SpeciesmtDNA Size (bp)Gene NumberIntergenic Space (%)Notable Features
Chlorokybus atmophyticus201,7637041%Largest green algal mtDNA
Mesostigma viride~42,424~57Lower4.8-fold smaller than Chlorokybus
Chaetosphaeridium globosumSimilar to CharaSimilar to CharaMore compactShares gene clusters with Chlorokybus
Chara vulgarisSimilar to ChaetosphaeridiumSimilar to ChaetosphaeridiumMore compactMost resembles land plant mtDNAs

These characteristics position Chlorokybus as a key model for understanding the evolutionary transitions in photosynthetic organisms .

What methodological approaches can elucidate the evolutionary relationships between petA genes across diverse photosynthetic lineages?

Investigating the evolutionary history of petA (encoding apocytochrome f) requires a comprehensive methodological framework:

  • Comparative genomic analysis:

    • Analyze conserved gene clusters containing petA across species

    • Chlorokybus shares with Chara, Chaetosphaeridium, and bryophytes 8-10 gene clusters encompassing about 20 genes

    • Use GRIMM or similar tools to estimate the number of rearrangements required to transform gene order between genomes

  • Phylogenetic reconstruction:

    • Employ multiple sequence alignment tools for petA sequences across diverse photosynthetic organisms

    • Implement maximum likelihood, Bayesian inference, and maximum parsimony methods to construct robust phylogenetic trees

    • Utilize both nucleotide and amino acid sequence data to account for different evolutionary rates

  • Synteny analysis:

    • Examine the genomic context of petA across species

    • Identify conserved gene linkages as evolutionary markers

    • Some clusters in Chlorokybus exhibit gene linkages not previously found outside the Streptophyta, suggesting they originated early in streptophyte evolution

  • Substitution rate analysis:

    • Calculate synonymous and non-synonymous substitution rates to identify selective pressures

    • Compare evolutionary rates between different photosynthetic lineages

    • Address analytical problems arising from accelerated sequence evolution in certain lineages (as observed with Mesostigma)

This multi-faceted approach provides robust evolutionary insights into the history of cytochrome f and its encoding gene across the diversity of photosynthetic organisms.

How can recombinant Chlorokybus atmophyticus apocytochrome f be utilized in cytochrome assembly pathway research?

Recombinant apocytochrome f serves as a valuable tool for investigating cytochrome assembly processes. Implement these methodological approaches:

  • Heterologous expression system studies:

    • Express Chlorokybus atmophyticus petA in E. coli strains engineered with different cytochrome assembly pathways

    • Measure holocytochrome f formation rates using heme staining after SDS-PAGE separation

    • Compare assembly efficiency across Systems I, II, and III to identify substrate recognition patterns

  • Investigation of assembly factors:

    • Co-express apocytochrome f with putative assembly factors (e.g., CCS5/HCF164)

    • Assess the ability of thioredoxin-like proteins to reduce the disulfide at the CXXCH motif

    • Quantify changes in heme attachment efficiency upon manipulation of assembly components

  • Signal peptide functionality studies:

    • Engineer chimeric constructs with different targeting sequences (e.g., replace native signal with Bordetella pertussis cytochrome c4 signal sequence)

    • Assess membrane translocation efficiency and processing in heterologous systems

    • Compare periplasmic vs. cytoplasmic localization effects on protein maturation

  • Redox environment manipulation:

    • Test the impact of thiol-disulfide oxidoreductases (e.g., DsbA, DsbC, DsbD) on apocytochrome f maturation

    • Examine how these components influence the redox state of the CXXCH motif

    • Address whether exogenous reductants like DTT can compensate for missing redox components

These approaches can illuminate the specific requirements for proper cytochrome assembly and the evolutionary conservation of these pathways.

What in vitro reconstitution methods can be used to study the bioenergetics of apocytochrome f to holocytochrome f conversion?

In vitro reconstitution offers controlled conditions to investigate the biochemical mechanisms of heme attachment to apocytochrome f. Implement these methodological strategies:

  • Purified component reconstitution:

    • Isolate purified apocytochrome f, heme, and assembly factors

    • Establish controlled redox conditions using defined ratios of oxidized/reduced glutathione

    • Monitor heme attachment using UV-visible spectroscopy (characteristic absorption shift at 550 nm upon heme attachment)

    • Quantify reaction kinetics under varying conditions (pH, temperature, ion concentration)

  • Membrane mimetic systems:

    • Incorporate apocytochrome f into liposomes or nanodiscs to simulate the native membrane environment

    • Investigate how the membrane environment influences heme attachment efficiency

    • Test the impact of membrane composition on protein folding and function

  • Energy requirements analysis:

    • Determine ATP dependence of the heme attachment process

    • Investigate whether proton motive force influences assembly efficiency

    • Assess the energetic cost of maintaining reduced cysteines in the CXXCH motif

  • Real-time monitoring approaches:

    • Employ fluorescence resonance energy transfer (FRET) with labeled assembly components

    • Use stopped-flow techniques to capture rapid kinetic processes

    • Implement surface plasmon resonance to measure binding affinities between apocytochrome f and assembly factors

These in vitro approaches complement the in vivo studies by isolating specific variables and providing mechanistic insights into the complex process of cytochrome maturation.

What are the critical parameters for maintaining the stability and activity of recombinant apocytochrome f?

Ensuring protein stability and preventing degradation are critical challenges when working with recombinant apocytochrome f. Implement these evidence-based strategies:

  • Storage optimization:

    • Store lyophilized protein at -20°C/-80°C for up to 12 months

    • For reconstituted protein, add 5-50% glycerol as a cryoprotectant

    • Divide into small aliquots to avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for no more than one week

  • Buffer composition considerations:

    • Use Tris/PBS-based buffer with 6% Trehalose at pH 8.0 for optimal stability

    • Include reducing agents (1-5 mM DTT or β-mercaptoethanol) to maintain reduced cysteines

    • Consider adding protease inhibitors for sensitive applications

    • Filter sterilize all buffers to prevent microbial contamination

  • Handling precautions:

    • Centrifuge vials briefly before opening to bring contents to the bottom

    • When reconstituting lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Avoid introducing air bubbles through aggressive pipetting or vortexing

  • Activity monitoring:

    • Periodically assess protein integrity by SDS-PAGE

    • Verify functionality through binding assays with known interaction partners

    • Monitor spectroscopic properties for indications of denaturation or aggregation

Adherence to these guidelines ensures maintenance of protein quality throughout your research activities.

What strategies can address common challenges in experimental studies of recombinant apocytochrome f?

Researchers working with apocytochrome f frequently encounter specific technical challenges. Implement these methodological solutions:

  • Addressing expression issues:

    • Problem: Low expression yields

    • Solution: Optimize codon usage for E. coli; reduce expression temperature to 16-20°C; test different E. coli strains (BL21, Rosetta, Origami)

    • Evidence: Expression systems optimized for membrane proteins have shown significant yield improvements

  • Enhancing solubility:

    • Problem: Inclusion body formation

    • Solution: Co-express with chaperones; fuse with solubility-enhancing tags (MBP, SUMO); add low concentrations of solubilizing agents during lysis

    • Evidence: Studies with related cytochromes demonstrate effectiveness of fusion partners in enhancing solubility

  • Improving heme attachment efficiency:

    • Problem: Incomplete conversion to holocytochrome

    • Solution: Ensure reducing environment during expression; co-express with appropriate assembly factors; supplement growth media with δ-aminolevulinic acid to enhance heme biosynthesis

    • Evidence: Thiol reduction requirements have been demonstrated for efficient heme attachment to CXXCH motifs

  • Resolving substrate specificity issues:

    • Problem: Variation in recognition by different assembly systems

    • Solution: System II shows broad recognition of CXXCH motifs from diverse sources, while System III exhibits higher specificity

    • Evidence: CcsBA from H. pylori can mature cytochromes from unrelated organisms as long as they contain the CXXCH motif

These approaches address common experimental hurdles and increase the likelihood of successful outcomes in apocytochrome f research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.