Recombinant Chlorokybus atmophyticus ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

This protein is synthesized via heterologous expression in Escherichia coli, followed by affinity chromatography. Commercial vendors provide the following specifications:

ParameterSpecification
Expression SystemE. coli cell-free system
Purity>90% (SDS-PAGE)
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C
ApplicationsELISA, structural studies, enzyme activity assays
Price$1,470–$1,532 (50 µg)
Supplier ReferencesMyBioSource , Creative BioMart , Anagnostics

Evolutionary Context

Chlorokybus atmophyticus belongs to the earliest-diverging streptophyte algae, sharing genomic traits with embryophytes (land plants) . Its ATP synthase subunits, including atpF, retain ancestral features linked to terrestrial adaptation:

  • Phylogenetic Significance: The atpF gene in Chlorokybus clusters with embryophyte homologs, reflecting conserved roles in photophosphorylation .

  • Environmental Adaptations: Subaerial habitats of Chlorokybus likely drove selection for robust ATP synthase complexes capable of operating under fluctuating hydration .

Research Applications

Recombinant atpF is pivotal for:

  • Mechanistic Studies: Probing stator-rotor interactions via crosslinking or cryo-EM .

  • Biotechnological Engineering: Modifying ATP synthase efficiency in crops by manipulating stator subunits .

  • Evolutionary Biology: Tracing structural innovations in streptophyte algae that enabled plant terrestrialization .

Challenges and Future Directions

Current limitations include the absence of high-resolution structures of Chlorokybus ATP synthase. Future work could leverage recombinant atpF to:

  • Resolve conformational changes during proton translocation.

  • Engineer synthetic ATP synthases with altered H+^+/ATP ratios for bioenergy applications .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Chlorokybus atmophyticus (Soil alga)
Target Names
atpF
Target Protein Sequence
MTDILTNMFTIVAELPLGEEEGFAFNGNILETNLINLAAVIGLLFYSGRSFLTNLLRNRE DNILKSIRDADERYKEATEKLQQAKNEFEQAKIEADEIRAQSRITAKEIEVSLMGLVSED TKRLIDMKQATISFEEEKAINEVRRQVIRLALQRALEQSKNRLNHRLQKRVTRLNIGLLG QLVGVND
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, housing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Chlorokybus atmophyticus and why is it significant in evolutionary studies?

Chlorokybus atmophyticus is a sarcinoid soil alga belonging to the Chlorokybales, representing one of the earliest diverging lineages of the Streptophyta phylum. This charophycean green alga has significant evolutionary importance as it helps us understand the ancestral state of photosynthetic organisms that led to land plants. Phylogenetically, it is closely related to Mesostigma viride, with both species forming a clade in trees based on chloroplast genome data . The evolutionary significance lies in its position at the base of the streptophyte lineage, making it invaluable for understanding the evolution of photosynthetic machinery including ATP synthase components.

What is the structure and function of ATP synthase subunit b in chloroplasts?

ATP synthase subunit b (atpF) is a critical component of the F₀ sector of chloroplastic ATP synthase. This protein forms part of the peripheral stalk that connects the membrane-embedded F₀ sector to the catalytic F₁ sector. The protein's primary function is structural stabilization of the ATP synthase complex while preventing rotation of the α₃β₃ hexamer during catalysis.

The atpF protein in Chlorokybus atmophyticus consists of 187 amino acids with a molecular structure that includes:

  • A membrane-spanning N-terminal domain

  • A hydrophilic C-terminal domain that interacts with the F₁ sector

  • Multiple alpha-helical regions that facilitate protein-protein interactions

These structural elements enable the protein to contribute to the tight coupling between proton translocation and ATP synthesis, which is essential for efficient photosynthetic energy conversion .

What are the optimal conditions for expressing recombinant Chlorokybus atmophyticus atpF in E. coli?

For optimal expression of recombinant Chlorokybus atmophyticus atpF in E. coli, researchers should consider the following protocol:

Expression System:

  • Host strain: BL21(DE3) or Rosetta(DE3) for handling potential rare codons

  • Expression vector: pET system with N-terminal His-tag as demonstrated in commercial preparations

Culture Conditions:

  • Medium: LB or 2×YT supplemented with appropriate antibiotics

  • Temperature: Initial growth at 37°C to OD₆₀₀ of 0.6-0.8, then shift to 18-20°C for protein expression

  • Induction: 0.1-0.5 mM IPTG (lower concentrations often yield better folding)

  • Duration: 16-18 hours at reduced temperature

Optimization Considerations:

  • Codon optimization for E. coli may improve expression levels

  • Addition of 0.2-1% glucose can reduce basal expression

  • Supplementation with 1-5% ethanol or osmolytes may improve protein folding

  • Co-expression with molecular chaperones (GroEL/GroES) may increase soluble protein yield

These conditions have been established to balance protein yield with proper folding, as membrane proteins and their components often present challenges in heterologous expression systems.

What purification protocols optimize yield and purity of recombinant Chlorokybus atmophyticus atpF?

A comprehensive purification protocol for recombinant His-tagged Chlorokybus atmophyticus atpF includes:

Cell Lysis:

  • Resuspend cell pellet in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM PMSF, protease inhibitor cocktail)

  • Disrupt cells via sonication or high-pressure homogenization

  • Clarify lysate by centrifugation at 20,000×g for 30 minutes

Immobilized Metal Affinity Chromatography (IMAC):

  • Load clarified lysate onto Ni-NTA resin equilibrated with lysis buffer

  • Wash with increasing imidazole concentrations (20-50 mM) to remove non-specific binding

  • Elute protein with 250-300 mM imidazole

Size Exclusion Chromatography:

  • Apply concentrated IMAC eluate to Superdex 75/200 column

  • Elute with 20 mM Tris-HCl pH 7.5, 150 mM NaCl

Quality Control:

  • Assess purity by SDS-PAGE (should exceed 90%)

  • Verify identity by Western blot and/or mass spectrometry

  • Analyze secondary structure by circular dichroism

Storage:

  • Add 6% trehalose as a stabilizing agent

  • Flash-freeze aliquots in liquid nitrogen

  • Store at -80°C to maintain stability

This protocol typically yields 5-10 mg of purified protein per liter of bacterial culture with purity exceeding 90% as determined by SDS-PAGE.

How can researchers assess the proper folding and stability of recombinant Chlorokybus atmophyticus atpF?

Researchers can employ multiple complementary techniques to assess proper folding and stability:

Structural Analysis:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV CD (190-260 nm) to evaluate secondary structure elements

    • Thermal denaturation to determine melting temperature (Tm)

  • Fluorescence Spectroscopy:

    • Intrinsic tryptophan fluorescence to assess tertiary structure

    • Use of hydrophobic probes (ANS, bis-ANS) to detect exposed hydrophobic patches

Functional Assays:

  • Binding assays with known interaction partners in the ATP synthase complex

  • Limited proteolysis to evaluate compact folding

  • Size exclusion chromatography to assess oligomeric state

Stability Assessment:

  • Differential Scanning Calorimetry (DSC)

  • Thermal Shift Assays using fluorescent dyes (SYPRO Orange)

  • Accelerated stability studies at various pH values and temperatures

Recommended Buffer Optimization:

ParameterRange to TestOptimal Conditions
pH6.0-9.07.5-8.0
NaCl0-500 mM150-300 mM
StabilizersGlycerol, trehalose, sucrose6% trehalose
Reducing agentsDTT, β-ME, TCEP1 mM TCEP

Properly folded atpF protein should display predominantly alpha-helical characteristics in CD spectroscopy, consistent with structural predictions based on homologous proteins from other photosynthetic organisms.

How does site-directed mutagenesis of conserved residues in Chlorokybus atmophyticus atpF affect ATP synthase function?

Site-directed mutagenesis of conserved residues in atpF can provide valuable insights into structure-function relationships. Key regions for mutagenesis include:

Transmembrane Domain Residues:
Mutations in the hydrophobic N-terminal region (approximately residues 10-30) can disrupt membrane anchoring, affecting the stability of the entire ATP synthase complex. Particularly important are the conserved glycine residues that provide flexibility within the membrane environment.

Stalk Region Residues:
The central portion of the protein (approximately residues 70-120) forms critical interactions with other subunits. Mutations in this region frequently affect the coupling efficiency between F₀ and F₁ sectors, resulting in decreased ATP synthesis without necessarily affecting assembly.

C-terminal Domain:
The C-terminal region (approximately residues 140-187) interacts with the F₁ sector. Mutations here typically affect the stability of these interactions rather than catalytic activity directly.

Experimental Approach:

  • Generate alanine scanning mutations throughout the protein

  • Express mutant proteins in a heterologous system

  • Reconstitute mutant proteins into liposomes with other ATP synthase subunits

  • Measure ATP synthesis/hydrolysis activities and proton translocation

Mutations in critical residues will provide mechanistic insights into how this protein contributes to the tight coupling between proton translocation and ATP synthesis, which is necessary for efficient cellular metabolism and energy conversion .

What approaches can be used to study the interaction of Chlorokybus atmophyticus atpF with other ATP synthase subunits?

Multiple complementary approaches can be employed to characterize protein-protein interactions between atpF and other ATP synthase subunits:

In Vitro Binding Assays:

  • Pull-down assays using His-tagged atpF as bait

  • Surface Plasmon Resonance (SPR) to measure binding kinetics and affinities

  • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

Structural Studies:

  • X-ray crystallography of co-crystals with interacting subunits

  • Cryo-electron microscopy of reconstituted complexes

  • Hydrogen/Deuterium Exchange Mass Spectrometry (HDX-MS) to map interaction interfaces

Crosslinking Approaches:

  • Chemical crosslinking followed by mass spectrometry (XL-MS)

  • Site-specific photocrosslinking using unnatural amino acids

  • In vivo crosslinking in reconstituted systems

Computational Methods:

  • Homology modeling based on known structures

  • Molecular dynamics simulations of subunit interactions

  • Coevolution analysis to predict interacting residues

These methodologies can collectively provide a comprehensive view of how Chlorokybus atmophyticus atpF interacts with other subunits, particularly when comparing results to the well-characterized ATP synthase complexes from other organisms. Such comparative analysis can highlight conserved interaction mechanisms as well as species-specific adaptations in this ancient charophycean green alga .

How can researchers reconstitute Chlorokybus atmophyticus ATP synthase in artificial membrane systems?

Reconstitution of functional ATP synthase in artificial membrane systems requires careful consideration of lipid composition and reconstitution methods:

Lipid Selection and Preparation:

  • Use a mixture of phosphatidylcholine (PC), phosphatidylethanolamine (PE), and cardiolipin to mimic native membrane composition

  • Prepare large unilamellar vesicles (LUVs) by extrusion through polycarbonate filters (100-200 nm)

  • Alternative: Form giant unilamellar vesicles (GUVs) using electroformation for single-molecule studies

Protein Preparation:

  • Purify all necessary ATP synthase subunits individually or co-express

  • Remove detergent from purified proteins via dialysis or detergent binding beads

  • Verify protein stability in detergent-free buffer conditions

Reconstitution Protocol:

  • Mix detergent-solubilized proteins with preformed liposomes

  • Gradually remove detergent using Bio-Beads or controlled dialysis

  • Separate proteoliposomes from non-incorporated protein by sucrose gradient centrifugation

Functional Verification:

  • ATP synthesis assay using acid-base transition

  • ATP hydrolysis measured by either Pi release or NADH-coupled enzyme assay

  • Proton pumping measured using pH-sensitive fluorescent dyes (ACMA, pyranine)

Data Analysis:

ParameterMethodExpected Result
Protein:Lipid RatioBradford assay & phosphate determination1:50-1:100 (w/w)
OrientationAccessibility to ATP~50% right-side out
ATP Synthesis RateLuciferase assay10-50 nmol/min/mg
Proton TranslocationFluorescence quenchingQuenching upon ATP addition

This reconstitution system provides a controlled environment to study the functional aspects of Chlorokybus atmophyticus ATP synthase, allowing researchers to manipulate conditions and compare properties with ATP synthases from other species along the evolutionary spectrum .

How does Chlorokybus atmophyticus atpF differ from homologous proteins in other photosynthetic organisms?

Comparative analysis reveals several distinctive features of Chlorokybus atmophyticus atpF compared to homologs in other photosynthetic organisms:

Sequence Conservation:
Alignment of Chlorokybus atmophyticus atpF with homologs from other charophycean algae, land plants, and distantly related photosynthetic organisms reveals:

  • Higher sequence similarity to land plant homologs than to those of chlorophyte algae

  • Conserved transmembrane domain architecture but variable sequence identity

  • Species-specific insertions/deletions in the connecting domains

Evolutionary Significance:
As one of the earliest diverging lineages of Streptophyta, Chlorokybus atmophyticus atpF represents an intermediate evolutionary state between chlorophyte algae and land plants . This position makes it valuable for understanding the evolution of the chloroplast ATP synthase structure and function during the transition to terrestrial environments.

Structural Adaptations:
The protein shows specific adaptations that may reflect the ecological niche of this soil alga, including:

  • Unique residue composition in the membrane-spanning regions

  • Modified surface charges that may influence interactions with other subunits

  • Lineage-specific sequence motifs that could alter the stability or assembly of the ATP synthase complex

These differences provide valuable insights into the evolutionary history of ATP synthase and the adaptation of the photosynthetic apparatus during the diversification of the plant kingdom.

What genomic insights can be gained from studying Chlorokybus atmophyticus organellar genomes?

The study of Chlorokybus atmophyticus organellar genomes provides significant insights into early streptophyte evolution:

Mitochondrial Genome Features:

  • Exceptionally large mitochondrial genome (201,763 bp), making it the largest known green algal mitochondrial genome

  • Contains 70 conserved genes, including some (nad10 and trnL(gag)) reported for the first time in streptophyte mtDNA

  • Gene density of only 41.4%, with substantial intergenic regions

  • Contains 6 group I and 14 group II introns

  • Short repeated sequences accounting for 7.5% of the genome

Evolutionary Implications:

  • Challenges the concept that mitochondrial genomes were constrained to remain compact during charophycean evolution

  • Suggests two waves of mitochondrial genome expansion during land plant evolution: one during the transition from charophycean algae to land plants and another with the emergence of angiosperms

  • Shows shared gene clusters with Chara, Chaetosphaeridium, and bryophytes, suggesting early origin during streptophyte evolution

Comparative Aspects:
The close resemblance between Chlorokybus mitochondrial genome and the mtDNA of the bryophyte Marchantia in terms of size, gene content, gene density, and abundance of repeats provides important clues about the ancestral state of plant organellar genomes.

These genomic insights help reconstruct the evolutionary history of photosynthetic organisms and better understand the development of the complex cellular machinery, including ATP synthase, that enabled the successful colonization of land by plants.

What are common challenges in expressing and purifying functional Chlorokybus atmophyticus atpF, and how can they be addressed?

Researchers commonly encounter several challenges when working with Chlorokybus atmophyticus atpF:

Expression Challenges:

  • Poor Expression Levels

    • Solution: Optimize codon usage for E. coli; try different promoter systems

    • Alternative: Use cell-free protein synthesis systems

  • Protein Misfolding/Aggregation

    • Solution: Lower induction temperature (16-18°C); reduce IPTG concentration

    • Alternative: Co-express with molecular chaperones (GroEL/GroES)

  • Toxicity to Host Cells

    • Solution: Use tight expression control systems (pLysS strains)

    • Alternative: Express toxic domains separately and reconstitute in vitro

Purification Challenges:

  • Low Solubility

    • Solution: Add mild detergents (0.1% DDM or 0.5% CHAPS)

    • Alternative: Use fusion partners (MBP, SUMO) to enhance solubility

  • Protein Instability

    • Solution: Include stabilizers (trehalose, glycerol) in all buffers

    • Alternative: Perform purification at 4°C with protease inhibitors

  • Non-specific Binding to Affinity Resin

    • Solution: Increase salt concentration (300-500 mM NaCl) and add low imidazole (10-20 mM) in wash buffers

    • Alternative: Try different affinity tags (Strep-tag II, FLAG)

Functional Verification Challenges:

  • Loss of Activity After Purification

    • Solution: Verify protein folding using biophysical methods

    • Alternative: Co-purify with interacting partners to stabilize native conformation

  • Inconsistent Activity Measurements

    • Solution: Standardize protein:lipid ratios in reconstitution experiments

    • Alternative: Use internal controls and multiple activity assays

Addressing these challenges through systematic optimization can significantly improve the yield and quality of functional Chlorokybus atmophyticus atpF protein for research applications.

How can researchers overcome difficulties in studying protein-protein interactions within the ATP synthase complex?

Investigating protein-protein interactions within the ATP synthase complex presents several challenges that can be addressed with specialized approaches:

Challenge: Complex Membrane Environment

  • Solution: Use native nanodiscs or amphipols to maintain the membrane environment

  • Strategy: Employ styrene-maleic acid (SMA) copolymers to extract membrane protein complexes with their native lipid environment

Challenge: Transient Interactions

  • Solution: Apply in vivo crosslinking prior to cell lysis

  • Strategy: Use photo-activatable unnatural amino acids incorporated at specific positions to capture transient interactions with temporal control

Challenge: Multiple Subunit Assembly

  • Solution: Employ multi-cistronic expression vectors for coordinated subunit production

  • Strategy: Utilize insect cell or mammalian expression systems for complex multi-subunit assemblies

Challenge: Distinguishing Direct vs. Indirect Interactions

  • Solution: Implement proximity labeling approaches (BioID, APEX)

  • Strategy: Use split reporter systems (split-GFP, split-luciferase) to verify direct interactions

Methodological Recommendations:

Interaction TypeRecommended MethodAdvantage
Stable interactionsCo-immunoprecipitationSimple, widely accessible
Weak/transientCrosslinking-MSCaptures fleeting interactions
In vivo verificationFRET/BRETReal-time monitoring in living cells
Binding kineticsBio-layer interferometryLabel-free, real-time measurements

What emerging technologies could advance our understanding of Chlorokybus atmophyticus ATP synthase function and evolution?

Several cutting-edge technologies are poised to revolutionize ATP synthase research:

Structural Biology Advancements:

  • Cryo-Electron Tomography: Enables visualization of ATP synthase in its native membrane environment at near-atomic resolution

  • Time-Resolved Cryo-EM: Could capture different conformational states during the rotational catalysis cycle

  • Integrative Structural Biology: Combining multiple techniques (X-ray crystallography, NMR, SAXS, and computational modeling) to build complete structural models

Single-Molecule Techniques:

  • High-Speed AFM: Allows direct visualization of ATP synthase rotary motion in real-time

  • Single-Molecule FRET: Can measure conformational changes during catalysis with nanometer precision

  • Magnetic Tweezers: Enable measurement of torque generation during ATP synthesis/hydrolysis

Synthetic Biology Approaches:

  • Minimal ATP Synthase Constructs: Engineering simplified versions to understand essential structural elements

  • Chimeric ATP Synthases: Creating hybrid complexes with subunits from different species to study evolutionary adaptations

  • De Novo Design: Rational design of ATP synthase variants with altered properties

Computational Methods:

  • Molecular Dynamics Simulations: Increasingly capable of modeling entire ATP synthase complexes in membrane environments

  • Machine Learning: Can identify evolutionary patterns and predict functional impacts of sequence variations

  • Quantum Mechanics/Molecular Mechanics (QM/MM): Provides insights into proton translocation and catalytic mechanisms

These technologies, especially when applied in combination, promise to yield unprecedented insights into the structure, function, and evolution of Chlorokybus atmophyticus ATP synthase and its role in the adaptation of photosynthetic organisms during the transition to land.

What are the potential applications of understanding Chlorokybus atmophyticus ATP synthase in biotechnology and synthetic biology?

Understanding Chlorokybus atmophyticus ATP synthase opens several promising avenues for biotechnological applications:

Bioenergy Applications:

  • Bio-inspired Energy Conversion: Designing artificial photosynthetic systems based on evolutionary insights from early diverging streptophytes

  • Nano-rotary Motors: Engineering ATP synthase as a nanomachine for molecular manufacturing

  • Synthetic Organelles: Creating artificial chloroplasts with optimized ATP production capabilities

Pharmaceutical Relevance:

  • Target Identification: Understanding evolutionary conservation of ATP synthase structure helps identify potential antimicrobial targets

  • Drug Delivery: ATP synthase-based nanoparticles for targeted drug delivery

  • Modulators of Bioenergetics: Compounds affecting ATP synthase function for treating mitochondrial disorders

Agricultural Applications:

  • Crop Improvement: Engineering more efficient ATP synthases for enhanced photosynthetic efficiency

  • Stress Tolerance: Developing plants with ATP synthases adapted to extreme environments based on insights from early-diverging algae

  • Biosensors: Creating ATP synthase-based sensors for monitoring environmental conditions

Evolutionary Synthetic Biology:

  • Ancestral Sequence Reconstruction: Recreating ancient ATP synthase variants to study evolutionary trajectories

  • Minimal ATP Synthase: Determining the minimal functional unit through systematic component reduction

  • Alternative Energy Coupling: Engineering ATP synthases that utilize alternative ion gradients

These applications leverage the unique evolutionary position of Chlorokybus atmophyticus as one of the earliest diverging streptophytes , providing insights into the ancestral adaptations that eventually enabled the evolution of land plants and their sophisticated energy conversion systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.