Recombinant Chlorokybus atmophyticus NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

What is NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) and what is its function in Chlorokybus atmophyticus?

NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is one of the 11 ndh genes encoding the NAD(P)H dehydrogenase complex in plant chloroplast genomes. In Chlorokybus atmophyticus, this protein functions as part of the cyclic electron transport chain in photosynthesis, facilitating electron transfer from NAD(P)H to plastoquinone. The full-length protein consists of 101 amino acids and contains characteristic transmembrane domains that anchor it within the thylakoid membrane. The amino acid sequence (MILDSLLILAASVFCIGIYGLITSRNVVRILMSLELLLNAVNINFVAFSNFIDSIEIKGQVISIFIMTIAAAEAAVGLALILAIYRNRDTVDIESFNLLKR) reveals its hydrophobic nature, consistent with its membrane-embedded function . Unlike some orchid species where ndh genes may be truncated or deleted, Chlorokybus atmophyticus retains a complete set of functional ndh genes in its chloroplast genome .

How does Chlorokybus atmophyticus ndhE differ from other charophytic algae and land plants?

The ndhE protein in Chlorokybus atmophyticus represents an interesting evolutionary position between aquatic algae and land plants. While the specific differences in ndhE structure are not fully characterized across all charophytic lineages, we can observe that Chlorokybus, as an early-diverging charophyte, shows distinct characteristics in its cell wall polysaccharides that suggest its ancestral position. Unlike land plants, Chlorokybus possesses anionic "pectic" polysaccharides with fundamentally different compositions, including the presence of sulphate groups, predominance of L-Gal, and abundance of D-GlcA . This suggests that other cellular components, including chloroplast proteins like ndhE, may also reflect this transitional evolutionary state. Research indicates that the evolution of land plant components since the last common ancestor with Chlorokybus has followed "a long and meandering path" with significant biochemical modifications .

What evolutionary significance does studying Chlorokybus atmophyticus ndhE have?

Studying Chlorokybus atmophyticus ndhE provides valuable insights into the evolution of photosynthetic machinery during the transition from aquatic to terrestrial environments. The retention of complete ndh genes in Chlorokybus contrasts with the selective loss of these genes in some plant lineages, particularly certain orchid species . This evolutionary pattern suggests that ndh genes, including ndhE, may have undergone selection pressure during land plant evolution. The phenomenon of ndh gene transfer from chloroplast to mitochondrial genomes, observed in various plant species, presents an intriguing aspect of organellar genome evolution. Research has shown that "ndh deletions did not correlate to known taxonomic or evolutionary relationships and deletions occurred independently after the orchid family split into different subfamilies" . Investigating these patterns in early-diverging charophytes like Chlorokybus provides a reference point for understanding the ancestral state of these genes before land colonization.

What are the recommended expression systems for producing recombinant Chlorokybus atmophyticus ndhE protein?

E. coli represents the most established expression system for producing recombinant Chlorokybus atmophyticus ndhE protein. When designing expression constructs, incorporating an N-terminal His-tag facilitates efficient purification while maintaining protein functionality . The complete amino acid sequence should be used for full-length expression (residues 1-101). For optimal expression, consider these methodological approaches:

• Codon optimization for E. coli expression

• Temperature regulation during induction (typically 18-25°C)

• IPTG concentration optimization (0.1-1.0 mM)

• Extended expression times (12-24 hours) at lower temperatures

Alternative expression systems, such as insect cells or cell-free systems, may be considered for specific research requirements, particularly when membrane protein folding is problematic in bacterial systems. When designing experiments to study ndhE function, consider using a systematic design of experiments (DOE) approach to optimize multiple variables simultaneously rather than one-factor-at-a-time methods .

What purification protocols are most effective for isolating Chlorokybus atmophyticus ndhE?

For His-tagged recombinant Chlorokybus atmophyticus ndhE, a stepwise purification protocol using nickel nitrilotriacetate (Ni-NTA) affinity chromatography under non-denaturing conditions yields high purity protein. The recommended protocol includes:

• Cell lysis in a Tris/PBS-based buffer (pH 8.0) containing protease inhibitors

• Initial binding to Ni-NTA resin

• Stepwise elution with increasing imidazole concentrations (10-250 mM)

• Buffer exchange to remove imidazole

• Quality assessment via SDS-PAGE (>90% purity standard)

For functional studies requiring native protein dimers or complexes, purification under non-denaturing conditions is critical. The approach used for NAD(P)H:quinone oxidoreductase heterodimer purification demonstrates that carefully controlled imidazole gradients can effectively separate tagged and untagged protein forms while preserving structural integrity . Following purification, the protein should be stored with 5-50% glycerol at -20°C/-80°C to maintain stability during long-term storage .

How can researchers effectively design experiments to study ndhE function in photosynthetic electron transport?

Designing robust experiments to study ndhE function requires a systematic approach following established design of experiments (DOE) principles. Rather than using trial-and-error or one-factor-at-a-time (OFAT) methods, researchers should implement factorial designs that simultaneously evaluate multiple factors affecting ndhE function . Consider this experimental design framework:

• Define clear response variables (electron transport rates, NAD(P)H oxidation rates)

• Identify key factors (pH, temperature, substrate concentrations, light intensity)

• Implement factorial design with appropriate replication

• Include positive and negative controls (known functional/non-functional ndh proteins)

• Analyze data using appropriate statistical methods

For in vitro functional assays, researchers can utilize spectrophotometric methods to monitor NAD(P)H oxidation (decrease in absorbance at 340 nm) coupled with quinone reduction. Reconstitution of purified ndhE into liposomes or nanodiscs may provide a more native-like environment for functional studies. When studying electron transport in vivo, researchers should consider chlorophyll fluorescence measurements and P700 redox kinetics to assess cyclic electron flow differences between wild-type and mutant/silenced systems .

How does the structure of Chlorokybus atmophyticus ndhE contribute to NAD(P)H dehydrogenase complex assembly?

The structure of Chlorokybus atmophyticus ndhE plays a critical role in the assembly and stability of the NAD(P)H dehydrogenase complex within the thylakoid membrane. While the high-resolution crystal structure of this specific protein has not been fully resolved, sequence analysis reveals characteristic hydrophobic regions essential for membrane integration. The 101-amino acid sequence of ndhE contains multiple transmembrane helices that anchor the protein within the lipid bilayer .

The assembly of the complete NAD(P)H dehydrogenase complex requires coordinated expression of all 11 ndh genes from the chloroplast genome. Research on NAD(P)H:quinone oxidoreductase demonstrates that subunit interactions are critical for complex formation and function. Studies utilizing heterodimer expression systems with tagged subunits have provided valuable insights into subunit cooperation and active site formation . For Chlorokybus atmophyticus ndhE, interaction domains with other subunits likely involve conserved residues that could be identified through site-directed mutagenesis and binding assays.

A proposed model for complex assembly would involve:

• Initial membrane insertion of hydrophobic subunits (including ndhE)

• Sequential recruitment of soluble components

• Conformational changes enabling electron transfer pathways

• Association with other photosynthetic complexes

What approaches can be used to investigate ndhE gene translocation between chloroplast and mitochondrial genomes?

Investigating ndhE gene translocation between organellar genomes requires sophisticated genomic and molecular biology techniques. Based on findings in orchid species, where ndh genes have been found transferred from chloroplast to mitochondrial genomes, researchers should implement a multi-faceted approach :

• Genome sequencing and comparative analysis:

  • Complete chloroplast and mitochondrial genome sequencing

  • Identification of ndh gene fragments in both organelles

  • Analysis of sequence homology and evolutionary patterns

• Transcriptomic analysis:

  • RNA-seq of chloroplast and mitochondrial transcripts

  • Identification of chimeric transcripts spanning organellar boundaries

  • Assessment of expression levels between native and translocated copies

• Functional validation:

  • Development of organelle-specific reporter constructs

  • Transformation experiments to confirm subcellular localization

  • Protein import assays using isolated organelles

Research has demonstrated that "the phenomenon of orchid ndh transfer to the mt genome existed in ndh-deleted orchids and also in ndh containing species" . This suggests that gene transfer between organelles may be more common than previously thought, making Chlorokybus atmophyticus an interesting model for studying the early evolution of these processes.

How can protein-protein interaction studies reveal the functional relationships between ndhE and other photosynthetic components?

Protein-protein interaction studies provide critical insights into how ndhE integrates within the photosynthetic machinery. Several complementary approaches should be considered:

• Co-immunoprecipitation (Co-IP):

  • Using anti-His antibodies to pull down His-tagged ndhE

  • Mass spectrometry identification of interaction partners

  • Validation with reverse Co-IP experiments

• Yeast two-hybrid (Y2H) or bacterial two-hybrid systems:

  • Construction of fusion proteins with DNA-binding and activation domains

  • Screening against cDNA libraries to identify novel interactions

  • Quantification of interaction strength through reporter gene expression

• Bimolecular fluorescence complementation (BiFC):

  • Split fluorescent protein fusions to ndhE and potential partners

  • Transient expression in protoplasts or stable transformation

  • Microscopic visualization of interaction sites within cells

• Cross-linking coupled with mass spectrometry:

  • Chemical cross-linking of protein complexes in native membranes

  • Digestion and identification of cross-linked peptides

  • Development of structural models based on distance constraints

These approaches have been successfully employed in studying NAD(P)H:quinone oxidoreductase subunit interactions, revealing that "subunit functional studies" can provide valuable insights into complex assembly and regulation . The expression of heterodimers with differentially tagged subunits offers a powerful approach for investigating the cooperative nature of enzyme function and electron transfer pathways.

What are common challenges in expressing and purifying functional Chlorokybus atmophyticus ndhE, and how can they be addressed?

Researchers frequently encounter several challenges when working with Chlorokybus atmophyticus ndhE protein. Here are the most common issues and their solutions:

• Poor expression yields:

  • Optimize codon usage for the expression host

  • Reduce expression temperature (18-20°C)

  • Test different E. coli strains (BL21(DE3), Rosetta, C41/C43)

  • Implement auto-induction media instead of IPTG induction

• Protein insolubility:

  • Include mild detergents (0.5-1% DDM, CHAPS, or Triton X-100)

  • Co-express with molecular chaperones (GroEL/GroES)

  • Test fusion partners (MBP, SUMO, or TrxA)

  • Optimize lysis buffer composition (pH, salt concentration)

• Protein instability:

  • Add stabilizing agents (glycerol 5-50%, reducing agents)

  • Maintain cold chain throughout purification

  • Include protease inhibitors in all buffers

  • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

• Low purity:

  • Implement stepwise imidazole elution (10, 20, 50, 100, 250 mM)

  • Consider additional purification steps (ion exchange, size exclusion)

  • Optimize washing steps to remove non-specifically bound proteins

  • Confirm purity by SDS-PAGE (>90% standard)

For reliable results, researchers should confirm proper protein folding through circular dichroism or fluorescence spectroscopy before conducting functional studies.

How can researchers properly interpret kinetic data from ndhE enzymatic assays?

Interpreting kinetic data from ndhE enzymatic assays requires careful consideration of multiple factors that influence NAD(P)H dehydrogenase activity. Follow these guidelines:

• Establish baseline parameters:

  • Determine Km values for both NADH and NADPH substrates

  • Calculate Vmax under optimal conditions

  • Assess the effects of pH and temperature on activity

  • Measure activity with different quinone acceptors

• Apply appropriate kinetic models:

  • Use Michaelis-Menten kinetics for simple substrate dependence

  • Consider allosteric models when substrate binding affects other sites

  • Implement global fitting approaches for complex mechanisms

  • Account for product inhibition effects

• Compare wild-type and mutant forms:

  • Generate heterodimers with one mutated subunit for comparative studies

  • Analyze how mutations affect Km and kcat parameters

  • Identify residues critical for catalysis versus substrate binding

• Data analysis considerations:

  • Apply statistical methods to determine significance of differences

  • Use non-linear regression for parameter estimation

  • Incorporate controls for non-enzymatic reactions

  • Consider the effects of protein stability over time

Studies with NAD(P)H:quinone oxidoreductase demonstrate that heterodimers with one mutated subunit (e.g., His-194→Ala) can dramatically affect Km values for NADPH, providing valuable insights into subunit cooperation . When analyzing kinetic data, researchers should employ design of experiments (DOE) principles to systematically evaluate how multiple factors interact to affect enzyme function .

How can researchers address data inconsistencies when comparing ndhE function across different experimental systems?

When inconsistencies arise in data comparing ndhE function across experimental systems, researchers should implement this systematic troubleshooting approach:

• Standardize experimental conditions:

  • Establish consistent buffer compositions, pH, and temperature

  • Standardize protein concentrations and purity criteria

  • Use identical substrate sources and preparation methods

  • Implement internal standards for normalization

• Validate protein quality across systems:

  • Confirm proper folding through spectroscopic methods

  • Verify oligomeric state via size exclusion chromatography

  • Assess post-translational modifications that may differ between systems

  • Ensure the His-tag or other modifications don't interfere with function

• Account for system-specific factors:

  • Consider differences in membrane composition between reconstitution systems

  • Evaluate the presence of accessory proteins in some systems but not others

  • Assess the impact of different electron donors/acceptors

  • Document metabolic state differences in whole-cell experiments

• Implementation of statistical approaches:

  • Use factorial designs to identify interaction effects between variables

  • Apply ANOVA to determine significance of observed differences

  • Calculate effect sizes to quantify the magnitude of system differences

  • Implement meta-analysis techniques when combining multiple datasets

Inconsistencies often stem from subtle differences in experimental design rather than true biological variation. Using DOE principles helps identify which factors significantly impact results and which represent random variation . When comparing recombinant systems with native complexes, remember that "charophyte 'pectins' are extractable by conventional land-plant methods, although they differ significantly in composition" , suggesting that other cellular components may also require adapted methodologies.

What are the most promising approaches for studying the role of ndhE in cyclic electron transport under stress conditions?

Future research on ndhE's role in cyclic electron transport during stress should focus on these promising approaches:

• CRISPR-Cas9 genome editing:

  • Generate precise point mutations in conserved domains

  • Create conditional knockout systems for temporal control

  • Develop fluorescent protein fusions for localization studies

  • Implement base editing for subtle functional modifications

• Advanced imaging techniques:

  • Apply cryo-electron microscopy to visualize complex assembly

  • Implement super-resolution microscopy for in vivo localization

  • Use FRET-based sensors to monitor electron transfer

  • Develop label-free imaging methods for native complex visualization

• Systems biology integration:

  • Combine transcriptomics, proteomics, and metabolomics data

  • Model electron flow under different stress conditions

  • Identify regulatory networks controlling ndh gene expression

  • Develop predictive models for stress response optimization

• Comparative studies across evolutionary lineages:

  • Analyze ndh gene conservation patterns across charophyte algae

  • Investigate functional differences between Chlorokybus and land plant homologs

  • Study species where ndh genes have been transferred to the mitochondrial genome

  • Examine the correlation between ndh function and habitat adaptation

Research has shown that in some species, ndh genes have been transferred from chloroplast to mitochondrial genomes, suggesting complex evolutionary dynamics . These comparative approaches may reveal how cyclic electron transport has adapted to different environmental conditions across plant evolution.

How might structural biology approaches advance our understanding of Chlorokybus atmophyticus ndhE?

Structural biology approaches offer transformative potential for understanding Chlorokybus atmophyticus ndhE:

• Cryo-electron microscopy (cryo-EM):

  • Determination of complete NAD(P)H dehydrogenase complex structure

  • Visualization of ndhE within its native membrane environment

  • Identification of interaction interfaces with other subunits

  • Comparison with structures from evolutionarily distant species

• X-ray crystallography:

  • High-resolution structure of isolated ndhE domains

  • Co-crystallization with binding partners or substrates

  • Analysis of conformational changes during catalytic cycle

  • Structure-guided design of specific inhibitors or activity modulators

• NMR spectroscopy:

  • Dynamic studies of membrane-embedded regions

  • Analysis of protein flexibility and domain movements

  • Investigation of substrate binding and product release

  • Characterization of disordered regions not resolved by other methods

• Computational approaches:

  • Molecular dynamics simulations of ndhE in membrane environments

  • Quantum mechanical calculations of electron transfer pathways

  • Homology modeling based on related proteins

  • In silico mutagenesis to predict functional impacts

What insights could comparative genomics provide about the evolutionary history of ndhE genes across charophytic algae and early land plants?

Comparative genomics approaches offer powerful tools for reconstructing the evolutionary history of ndhE genes:

• Phylogenomic analysis:

  • Construction of comprehensive ndh gene phylogenies

  • Dating of gene duplication and loss events

  • Correlation of evolutionary patterns with ecological transitions

  • Identification of selection signatures in different lineages

• Synteny and gene order studies:

  • Analysis of genomic context conservation across species

  • Identification of rearrangement events affecting ndh genes

  • Investigation of co-evolution with functionally related genes

  • Tracking of gene translocations between organellar genomes

• Regulatory element analysis:

  • Comparison of promoter regions across charophyte lineages

  • Identification of conserved transcription factor binding sites

  • Analysis of RNA editing patterns affecting ndh transcripts

  • Investigation of post-transcriptional regulatory mechanisms

• Horizontal gene transfer assessment:

  • Detection of potential HGT events involving ndh genes

  • Analysis of codon usage and nucleotide composition biases

  • Investigation of gene transfer between organellar genomes

  • Examination of integration mechanisms for transferred genes