Recombinant Chlorokybus atmophyticus NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Chlorokybus atmophyticus NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG), is a bacterial-expressed protein critical for photosynthetic electron transport and stress response in streptophyte algae. While direct commercial production of this protein from Chlorokybus is not yet documented, homologs like Mesostigma viride ndhG (Q9MUL3) and Nymphaea alba ndhG (Q6EVZ7) provide structural and functional parallels . This enzyme is part of the chloroplast NAD(P)H dehydrogenase complex, facilitating quinone reduction to prevent reactive oxygen species (ROS) accumulation .

Molecular Composition

  • Amino Acid Sequence: The ndhG subunit typically comprises 177–189 residues, with conserved domains for quinone binding and FAD cofactor interaction. For example, Mesostigma viride ndhG (1-189aa) includes a His-tag and features transmembrane helices critical for membrane anchoring .

  • Post-Translational Modifications: Expressed in E. coli with an N-terminal His-tag, the recombinant protein is purified to >90% homogeneity via affinity chromatography .

PropertyMesostigma viride ndhG Nymphaea alba ndhG
Length189 residues177 residues
Molecular Weight~21 kDa (calculated)~20 kDa (calculated)
Isoelectric Point8.9 (predicted)8.5 (predicted)
Expression SystemE. coliE. coli

Electron Transport and Detoxification

  • Mechanism: Catalyzes the two-electron reduction of plastoquinone to plastoquinol via FAD, bypassing semiquinone radical formation .
    NAD(P)H + quinoneNAD(P)++hydroquinone\text{NAD(P)H + quinone} \rightarrow \text{NAD(P)}^+ + \text{hydroquinone}

  • Stress Response: Stabilizes p53 under oxidative stress, linking chloroplast redox balance to nuclear signaling pathways .

Ecophysiological Relevance in Chlorokybus

  • Chloroplast Genome: Chlorokybus atmophyticus retains a gene-rich chloroplast genome (152 kbp) with conserved NAD(P)H dehydrogenase subunits, including ndhG .

  • Cryptic Speciation: Recent genomic studies reveal deep genetic divergence among Chlorokybus species, suggesting potential functional variability in ndhG across lineages .

Streptophyte Lineage

  • Evolutionary Position: Chlorokybus represents one of the earliest-diverging streptophyte algae, sister to land plants . Its chloroplast genome shares synteny with Mesostigma viride, retaining ancestral traits like low intron density .

  • Genomic Adaptations: The Chlorokybus chloroplast genome exhibits a 63.8% A+T content, with ndhG located in a conserved operon alongside other NAD(P)H dehydrogenase subunits .

Research Implications

  • Biotechnological Applications: Engineered ndhG variants could enhance stress tolerance in crops by modulating chloroplast redox states.

  • Evolutionary Studies: Comparative analyses of ndhG across streptophytes (e.g., Chlorokybus, Mesostigma, Chara) may clarify the transition from aquatic algae to land plants .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Chlorokybus atmophyticus (Soil alga)
Target Names
ndhG
Target Protein Sequence
MILAEGVQKFSLFFLEGAVLVGALGVVLLPNILYSAFLLGGVLMSIAGIYLLLNADFVAA AQVLIYVGAINVLILFAIMLVNKNDGRVAAGTSNSSGVTNNIIGLTCIGLAGFLIDMIVT TPWLPKGVAVATSLSAKADSTAAQTQLKGSISIIGLHIFSDFLLPFEVISLLLLVTLVGA IVIARRERLSDLEISKISLLNLPDPSNGKTPSLK
Uniprot No.

Target Background

Function
NDH functions as an electron shuttle, transferring electrons from NAD(P)H:plastoquinone to quinones within the photosynthetic and potentially chloroplast respiratory chains. It utilizes FMN and iron-sulfur (Fe-S) centers in this process. In this organism, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of Chlorokybus atmophyticus in streptophyte research?

Chlorokybus atmophyticus represents one of the deepest branches in the Streptophyta clade according to chloroplast genome-based phylogenetic studies . Recent research has revealed that Chlorokybophyceae (formerly considered a monotypic class with C. atmophyticus as its sole species) actually contains multiple cryptic species with significant genetic divergence. This taxonomic group forms a clade with Mesostigmatophyceae and Spirotaenia that diverged earliest from the lineage leading to land plants . Understanding C. atmophyticus and its plastid genes like ndhG is therefore crucial for elucidating the evolutionary trajectory of photosynthetic mechanisms during the transition from aquatic algae to terrestrial plants.

How does the ndhG gene in Chlorokybus atmophyticus compare structurally to orthologs in other streptophyte lineages?

The ndhG gene in C. atmophyticus encodes subunit 6 of the NAD(P)H-dehydrogenase complex located in the chloroplast. While specific structural comparison data for this gene across all streptophyte lineages is limited in the provided sources, research on plastid genome architecture indicates high conservation of certain genomic regions across evolutionarily distant lineages. The plastid genome of C. atmophyticus exhibits ancestral characteristics that help researchers understand the structural evolution of chloroplast genes like ndhG .

In streptophytes, plastid genome analysis reveals:

Organism GroupGenome Architecture PatternndhG Conservation Level
Early-diverging streptophytes (including C. atmophyticus)Highly rearranged compared to land plantsPresent with ancestral features
Florideophyceae (red algae)Highly conserved architectureOften absent (parallel loss)
Seed plantsHighly conserved architectureVariable presence/absence

What is known about the taxonomic diversity within Chlorokybus that might affect ndhG gene studies?

Recent phylogenomic analyses have uncovered significant cryptic diversity within what was previously considered a single species. Research has formally extended the Chlorokybophyceae by describing four new species in addition to C. atmophyticus: C. melkonianii, C. bremeri, C. cerffii, and C. riethii . This taxonomic revision has important implications for research on plastid genes like ndhG, as expression patterns can vary significantly between these species despite morphological similarities.

Gene expression analysis reveals marked differences in steady-state gene expression levels among different Chlorokybus species when grown under identical conditions. For instance, C. riethii exhibits the most divergent expression profile, followed by C. bremeri, while C. atmophyticus and C. melkonianii show more similar, though still distinct, profiles . These differences suggest potential functional variation in plastid genes including ndhG across the genus.

How should experimental controls be designed when studying recombinant ndhG expression from Chlorokybus atmophyticus?

When designing experiments for recombinant ndhG expression, implementing proper controls is essential for valid results. A robust experimental design should include:

  • Negative controls: Expression systems without the ndhG insert to account for background activity and non-specific protein interactions.

  • Positive controls: Well-characterized homologous genes from model organisms (e.g., Arabidopsis thaliana ndhG) expressed under identical conditions.

  • Empty vector controls: Expression vectors containing no insert to identify vector-specific effects on host cell metabolism.

  • Species-specific controls: When possible, compare recombinant ndhG expression with native expression in different Chlorokybus species to account for the recently discovered genetic diversity within this genus .

The experimental design should follow true experimental research principles with randomization and appropriate replication. This includes random distribution of variables and clear manipulation of independent variables (e.g., expression conditions, vector design, host cell type) . For instance, when testing expression efficiency under different conditions, randomly assign cultures to treatment groups and include biological replicates to account for variability.

What considerations should be made when designing primers for amplifying the ndhG gene from different Chlorokybus species?

Primer design for ndhG amplification from Chlorokybus species requires careful consideration of several factors:

  • Genetic diversity: Recent phylogenomic analyses have revealed significant genetic divergence among Chlorokybus species . Primers should be designed based on:

    • Conserved regions identified through multiple sequence alignments of available Chlorokybus ndhG sequences

    • Flanking regions that show lower mutation rates across species

  • Codon optimization: Consider codon usage bias if the amplified gene will be expressed in heterologous systems.

  • Secondary structure: Analyze potential secondary structures in the target region that might impede primer annealing.

A methodological approach includes:

  • Obtain sequences from multiple Chlorokybus species isolates (ACOI 1086, SAG 2609, SAG 2611, etc.)

  • Perform multiple sequence alignment to identify conserved regions

  • Design degenerate primers for regions with minor variations

  • Validate primers through in silico PCR before experimental use

What variables should be controlled when comparing ndhG function between different Chlorokybus species?

When comparing ndhG function across different Chlorokybus species, controlling extraneous variables is essential for valid comparisons . Key variables to control include:

  • Growth conditions: Standardize light intensity, photoperiod, temperature, media composition, and culture age to minimize physiological variations unrelated to genetic differences.

  • RNA/protein extraction protocols: Use identical extraction, purification, and quantification methods across all samples.

  • Experimental timing: Conduct all comparative analyses within a narrow timeframe to minimize batch effects.

  • Genetic background: Account for differences in genetic backgrounds among species by including multiple isolates of each species when possible.

  • Expression normalization: Select appropriate reference genes for qPCR that show stable expression across all studied Chlorokybus species.

Experimental design table for species comparison:

VariableControl MethodValidation Approach
Light conditionsGrowth chambers with identical settingsLight meter measurements
Media compositionSingle batch preparationChemical analysis of key components
Growth phaseOD measurement for cell densityGrowth curve monitoring
RNA integrityRIN (RNA Integrity Number) assessmentBioanalyzer verification
Reference genesStability assessment (e.g., geNorm)CV% across samples <5%

What are the optimal expression systems for functional studies of recombinant Chlorokybus atmophyticus ndhG?

Selecting an appropriate expression system for recombinant C. atmophyticus ndhG requires considering the protein's chloroplastic origin and potential functional requirements:

  • Prokaryotic systems:

    • E. coli: Suitable for basic structural studies but lacks post-translational modifications

    • Synechocystis sp.: Cyanobacterial system that provides a more native-like environment for chloroplast proteins

  • Eukaryotic systems:

    • Chlamydomonas reinhardtii: Green algal system with chloroplast machinery

    • Nicotiana benthamiana: Plant-based transient expression system for chloroplast-targeted proteins

The methodological approach to system selection includes:

  • Pilot expression trials in multiple systems

  • Western blot analysis for expression verification

  • Localization studies using fluorescent tagging

  • Activity assays to confirm functional expression

For chloroplastic proteins like ndhG, chloroplast transformation systems may provide advantages over nuclear transformation with chloroplast targeting, especially when studying assembly into native complexes.

How can protein-protein interactions between ndhG and other NDH complex subunits be effectively studied?

Studying protein-protein interactions involving ndhG requires specialized approaches to accommodate membrane protein characteristics:

  • Co-immunoprecipitation (Co-IP):

    • Use epitope-tagged ndhG expressed in appropriate host systems

    • Employ membrane-compatible detergents (digitonin, n-dodecyl β-D-maltoside)

    • Verify interactions through western blot or mass spectrometry

  • Split-reporter systems:

    • BiFC (Bimolecular Fluorescence Complementation) with chloroplast targeting

    • Split-ubiquitin system adapted for chloroplast membrane proteins

  • Crosslinking mass spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers like DSP or formaldehyde

    • Analyze crosslinked peptides through specialized MS/MS approaches

  • Cryo-electron microscopy:

    • For structural characterization of the entire NDH complex

    • Requires purification of intact complexes from recombinant or native sources

When designing these experiments, proper controls are essential, including non-interacting protein pairs, competitive binding assays, and validation through multiple independent techniques .

What approaches can be used to study the evolutionary conservation of ndhG function across the newly described Chlorokybus species?

To study evolutionary conservation of ndhG function across the recently discovered Chlorokybus species diversity , researchers can implement:

  • Comparative genomics:

    • Sequence analysis of ndhG from all five Chlorokybus species

    • Calculation of dN/dS ratios to assess selective pressure

    • Identification of conserved domains versus variable regions

  • Complementation studies:

    • Express ndhG from different Chlorokybus species in model systems with ndhG knockouts

    • Quantify functional restoration using physiological parameters

  • Transcriptomics:

    • Compare expression patterns under identical conditions across species

    • Identify co-expressed genes that may indicate functional conservation/divergence

  • Structural biology:

    • Predict protein structures using comparative modeling

    • Identify structurally conserved residues that may indicate functional importance

  • Biochemical characterization:

    • Express recombinant ndhG from multiple species

    • Compare enzymatic parameters (Km, Vmax) and substrate specificity

This multi-faceted approach allows researchers to distinguish between sequence conservation and functional conservation, providing insights into evolutionary constraints on ndhG.

How should researchers interpret unexpected differences in ndhG expression patterns between Chlorokybus species?

When encountering unexpected differences in ndhG expression between Chlorokybus species, researchers should:

  • Verify technical factors:

    • Confirm RNA/DNA quality metrics across all samples

    • Rule out primer-binding site polymorphisms through sequence analysis

    • Validate reference genes for stability across all tested species

  • Consider biological explanations:

    • Examine physiological differences between species that might influence energy requirements

    • Investigate potential environmental adaptations of different species

    • Consider the recent finding that gene expression patterns differ significantly between Chlorokybus species even under identical growth conditions

  • Explore regulatory mechanisms:

    • Analyze promoter regions for sequence differences

    • Investigate potential post-transcriptional regulation

    • Consider epigenetic factors that might differ between species

  • Apply statistical approaches:

    • Use appropriate statistical tests considering the experimental design

    • Account for multiple testing when analyzing transcriptome-wide data

    • Consider sample size limitations in interpretation

Expression differences may reflect true biological variation related to the deep genetic structure within Chlorokybus , rather than experimental artifacts.

What statistical approaches are most appropriate for analyzing comparative data on ndhG function across streptophyte lineages?

When analyzing comparative data on ndhG function across streptophyte lineages, researchers should select statistical approaches that account for:

  • Phylogenetic non-independence:

    • Implement phylogenetic comparative methods (PCM)

    • Use phylogenetic generalized least squares (PGLS) regression

    • Apply phylogenetic ANOVA for multi-group comparisons

  • Data normality and distribution:

    • Assess data distribution before selecting parametric/non-parametric tests

    • Consider transformations when appropriate

    • Use robust statistics when assumptions cannot be met

  • Multiple testing correction:

    • Apply Benjamini-Hochberg procedure for false discovery rate control

    • Use Bonferroni correction for family-wise error rate control

    • Consider the biological context when interpreting statistical significance

  • Sample size limitations:

    • Calculate effect sizes alongside p-values

    • Consider Bayesian approaches for small sample sizes

    • Acknowledge power limitations transparently

Statistical methodology should be determined during experimental design rather than after data collection to avoid bias , particularly when comparing newly described Chlorokybus species with limited available isolates.

How can researchers distinguish between convergent evolution and conserved ancestral features when analyzing ndhG sequences from different algal lineages?

Distinguishing between convergent evolution and ancestral conservation requires sophisticated analytical approaches:

  • Phylogenetic reconstruction:

    • Construct robust phylogenetic trees using appropriate models

    • Compare gene trees with species trees to identify incongruence

    • Implement tests for topological constraints to evaluate alternate hypotheses

  • Ancestral sequence reconstruction:

    • Infer ancestral sequences at key nodes in the phylogeny

    • Compare derived sequences to ancestral states

    • Quantify the probability of specific evolutionary paths

  • Selection analysis:

    • Calculate site-specific selection patterns (dN/dS)

    • Identify convergent sites under positive selection

    • Apply branch-site tests to detect lineage-specific selection

  • Structure-function mapping:

    • Correlate sequence conservation with known functional domains

    • Identify sites under similar selective pressures in independent lineages

    • Map conserved residues onto protein structural models

  • Comparative genomic context:

    • Analyze genome architecture surrounding ndhG

    • Compare gene order and operon structure across lineages

    • Consider the parallel evolution of plastid genome architecture observed in distantly related lineages like red seaweeds and seed plants

How does the discovery of multiple Chlorokybus species impact our understanding of early streptophyte evolution?

The recent discovery of multiple Chlorokybus species through phylogenomic analysis significantly impacts our understanding of early streptophyte evolution in several ways:

  • Diversity at deep nodes: The unexpected diversity within Chlorokybus indicates greater complexity at the earliest branches of streptophyte evolution than previously recognized. This diversity may reflect ancient divergences that occurred early in land plant evolution.

  • Genetic structure: The consistent deep genetic structure within Chlorokybus isolates suggests substantial evolutionary time since divergence, potentially representing "living fossils" of different early streptophyte lineages.

  • Physiological variation: Differences in gene expression patterns among Chlorokybus species suggest functional diversity that might have influenced adaptation to different microenvironments during early streptophyte evolution.

  • Taxonomic implications: The revised taxonomy reflecting multiple Chlorokybus species necessitates reevaluation of previous studies that treated all Chlorokybus isolates as a single species.

  • Molecular clock calibration: The discovery provides potential new calibration points for molecular clock studies of streptophyte evolution.

This newly recognized diversity provides opportunities to study plastid genes like ndhG across closely related but deeply diverged lineages, potentially revealing patterns of molecular evolution that were previously invisible.

What role might ndhG have played in the adaptation of early streptophytes to different environmental conditions?

The ndhG gene, encoding a subunit of the chloroplastic NDH complex, likely played significant roles in environmental adaptation of early streptophytes:

  • Cyclic electron flow regulation: The NDH complex participates in cyclic electron flow around photosystem I, which helps balance ATP/NADPH ratios under fluctuating light conditions.

  • Photoprotection: NDH-mediated cyclic electron flow contributes to photoprotection under high light stress, potentially crucial during the transition to terrestrial environments.

  • CO₂ concentration: The NDH complex in some photosynthetic organisms participates in carbon-concentrating mechanisms, potentially important for adaptation to environments with varying CO₂ availability.

  • Water stress response: Chloroplast NDH activity has been linked to responses to drought stress in land plants, suggesting potential roles in early adaptation to terrestrial conditions.

The expression differences observed among Chlorokybus species might reflect adaptations to different microenvironments, providing clues about the selective pressures that shaped early streptophyte evolution. Examining ndhG sequence and expression across the newly described Chlorokybus diversity could reveal signatures of adaptive evolution in this ancient lineage.

How does plastid genome architecture conservation in multicellular lineages affect the interpretation of ndhG evolution?

The parallel evolution of highly conserved plastid genome architecture in red seaweeds and seed plants, despite their divergence over one billion years ago , has important implications for interpreting ndhG evolution:

  • Architectural constraints: High conservation in genome architecture suggests strong selective pressure maintaining certain gene arrangements, potentially affecting ndhG evolution through linkage to other essential genes.

  • Recombination patterns: Conservation patterns in plastid genomes are explained by recombination events involving duplicated rDNA operons , which may influence the evolutionary trajectory of genes like ndhG through altered recombination landscapes.

  • Convergent selection: The parallel evolution observed in distantly related multicellular lineages suggests similar selective pressures operating on plastid genomes despite vast phylogenetic distance, potentially affecting ndhG through similar functional constraints.

  • Evolutionary rate heterogeneity: While architecture may be conserved, substitution rates may vary across lineages and genes. Research should examine whether ndhG shows similar patterns of sequence conservation as observed for genome architecture.

  • Multicellularity correlation: The observation that highly conserved plastid genome architectures correlate with multicellularity in both red and green lineages raises questions about whether plastid genes like ndhG might have played roles in the evolution of multicellular forms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.