Recombinant Chlorokybus atmophyticus Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you require a specific format, please specify this during order placement.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Chlorokybus atmophyticus (Soil alga)
Target Names
ycf4
Target Protein Sequence
MTNSSIDSKSDLIRRDPVLGSRRLSNYWWATVILVGASGFFLVGISSYFGFNLVPFIKSE EILFIPQGLVMSFYGVAGILLSVYLWLTIIWNVGEGYNEYNKQDGIVRIFRWGFPGKNRR IDLVYPIQDVQAIRVEIKEGINPRRVIYLKIKGKREIPLTRIGQPLTLGEIEEKAANLAR FLQVSIEGL
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of Ycf4 in photosynthetic organisms and how was it identified?

Ycf4 (hypothetical chloroplast reading frame no. 4) functions as a critical assembly factor for photosystem I (PSI) in photosynthetic organisms. Initially identified through comparative genomic analyses of chloroplast genomes, Ycf4's role has been experimentally confirmed through knockout studies.

The protein specifically facilitates the association of redox cofactors, chromophores, and Fe-S clusters during PSI assembly. Research in Chlamydomonas reinhardtii has shown that Ycf4-deficient mutants cannot develop photoautotrophically or accumulate PSI complexes . These findings indicate that while Ycf4 is not involved in PSI subunit synthesis, it plays a critical role in the assembly process of the PSI complex .

Methodologically, researchers identify Ycf4 function through:

  • Comparative genomic analyses of chloroplast DNA

  • Targeted gene knockout studies using homologous recombination

  • Protein-protein interaction assays to determine binding partners

  • Transmission electron microscopy to observe structural changes in chloroplasts following Ycf4 deletion

  • What is the phylogenetic position of Chlorokybus atmophyticus and why is it significant for studying Ycf4?

Chlorokybus atmophyticus belongs to Chlorokybophyceae, one of the earliest diverging lineages in the streptophyte clade. Phylogenomic analyses have placed Chlorokybophyceae, along with Mesostigmatophyceae and Spirotaenia spp., as the sister group to all other streptophytes, making it extremely valuable for evolutionary studies of photosynthesis .

This phylogenetic position is significant for Ycf4 research because:

  • Chlorokybus represents one of the earliest evolutionary branches of the lineage leading to land plants

  • Studying Ycf4 in this organism provides insights into the ancestral function of this protein

  • Comparative analyses between Chlorokybus Ycf4 and that of other photosynthetic organisms help trace the evolution of photosystem assembly mechanisms

Robust phylogenetic trees based on 529 densely sampled loci (with only 17% missing data) have confirmed this evolutionary position, making Chlorokybus Ycf4 an ideal subject for studying the ancestral characteristics of this important photosynthetic assembly factor .

  • How is the chloroplast genome of Chlorokybus organized and how does this affect Ycf4 expression?

The chloroplast genome structure of Chlorokybus atmophyticus, like other early-diverging streptophytes, possesses several distinctive features that impact Ycf4 expression:

  • Unlike many chloroplast genomes, Chlorokybus lacks the quadripartite structure with large inverted repeats (IRs) seen in many land plants

  • The genome organization reflects a more ancestral state of chloroplast DNA structure

  • Gene ordering and clustering in Chlorokybus shows the preservation of crucial gene clusters involved in photosynthesis

Research methodologies used to determine these features include:

  • Complete chloroplast genome sequencing using next-generation sequencing technologies

  • Comparative genomic analysis across multiple streptophyte lineages

  • Gene expression studies under different environmental conditions

The expression of Ycf4 in Chlorokybus appears to be constitutive but may be influenced by environmental factors, as suggested by gene expression differences among related Chlorokybus species when grown under identical experimental conditions .

  • What techniques are used to produce recombinant Chlorokybus atmophyticus Ycf4 protein?

Production of recombinant Chlorokybus atmophyticus Ycf4 protein typically involves:

  • Gene cloning and vector construction:

    • PCR amplification of the Ycf4 gene from Chlorokybus atmophyticus genomic DNA

    • Insertion into an appropriate expression vector (often with GST or His-tag for purification)

    • Verification of correct sequence through DNA sequencing

  • Expression systems:

    • Expression in E. coli hosts (typically BL21 or similar strains)

    • Use of inducible promoters (like T7) for controlled expression

    • Optimization of culture conditions (temperature, induction time, media composition)

  • Protein purification:

    • Cell lysis through sonication or mechanical disruption

    • Affinity chromatography using the fusion tag (GST/His)

    • Further purification through ion exchange or size exclusion chromatography

    • Verification of purity through SDS-PAGE

  • Functional verification:

    • Autophosphorylation assays (if studying kinase activity)

    • Protein-protein interaction studies

    • Structural analysis through techniques like circular dichroism

Similar approaches have been successfully used for other chloroplast proteins, as demonstrated in studies on Chloroplast Sensor Kinase (CSK) .

Intermediate Research Questions

  • How do knockout studies of Ycf4 inform our understanding of photosystem assembly mechanisms?

Knockout studies of Ycf4 have provided crucial insights into the mechanisms of photosystem assembly, revealing functional differences across species:

OrganismKnockout MethodPhenotypePhotosynthetic CapacityReference
Tobacco (partial knockout, 93aa from N-terminus)Homologous recombinationLight greenPhotoautotrophic growth possible
Tobacco (complete knockout)Homologous recombinationLight green to yellow leavesCannot grow photoautotrophically
Chlamydomonas reinhardtiiGene disruptionDeficient in PSIUnable to grow photoautotrophically

These studies have revealed:

  • The essential nature of Ycf4 varies across species, with complete knockout in tobacco preventing photoautotrophic growth, while partial knockout still permits survival .

  • The C-terminal domain (91 amino acids) appears particularly critical for function, as demonstrated by in silico protein-protein interaction studies showing stronger interactions between the C-terminus and photosystem-I subunits (psaB, psaC, psaH, and LHC) .

  • Methodologically, these studies employ:

    • Targeted gene replacement through homologous recombination

    • PCR and Southern blot verification of knockout

    • Phenotypic characterization including growth assays, chlorophyll measurements, and electron microscopy

    • Transcriptome analysis to assess effects on gene expression

The ultrastructural changes in chloroplasts following Ycf4 deletion (observed through transmission electron microscopy) show disorganization of thylakoid membranes and formation of vesicular structures, further supporting its critical role in photosystem assembly and maintenance .

  • What evidence supports different evolutionary relationships between Chlorokybus Ycf4 and other photosynthetic organisms?

Evolutionary relationships of Chlorokybus Ycf4 have been studied using multiple approaches, revealing complex patterns:

  • Phylogenomic evidence:

    • Robust phylogenetic trees based on 529 loci support Chlorokybus (along with Mesostigmatophyceae and Spirotaenia) as sister to all other streptophytes

    • Analysis of chloroplast genomes confirms the monophyletic nature of Chlorellaceae and establishes the position of Chlorokybus in streptophyte evolution

  • Structural genomic evidence:

    • Gene content analysis shows conservation of key photosynthetic genes across evolutionary lineages

    • Intron content analysis reveals patterns of gain and loss through evolution

    • Gene ordering data supports the early divergence of Chlorokybus

  • Protein sequence evidence:

    • Conserved domains in Ycf4 across different lineages indicate functional importance

    • Sequence divergence rates correlate with phylogenetic distance

Methodologically, researchers use:

These multiple lines of evidence strengthen our understanding of the evolutionary relationships of Chlorokybus Ycf4 within the green plant lineage.

  • How does the structure of Ycf4 relate to its function in photosystem I assembly?

The structure-function relationship of Ycf4 in photosystem I assembly involves several key aspects:

  • Structural domains:

    • The C-terminal domain (91 amino acids) appears critical for function

    • Protein-protein interaction studies show stronger interactions between the C-terminus and photosystem-I subunits

    • Conserved structural elements across species suggest functional importance

  • Functional interactions:

    • Ycf4 interacts directly with PSI subunits psaB, psaC, and psaH

    • It also shows interactions with Light-Harvesting Complex (LHC) proteins

    • Interactions with both large (chloroplast-encoded) and small (nuclear-encoded) subunits of RuBisCO suggest broader roles beyond PSI assembly

  • Mechanistic insights:

    • Ycf4 likely functions as a scaffold during PSI assembly

    • It may facilitate the incorporation of cofactors into the growing PSI complex

    • The protein appears to stabilize assembly intermediates during biogenesis

Research methodologies to study these aspects include:

  • In silico protein structure prediction

  • Protein-protein interaction assays (yeast two-hybrid, co-immunoprecipitation)

  • Mutagenesis studies targeting specific domains

  • Comparative analysis of Ycf4 across species with different PSI complexities

Understanding this structure-function relationship is crucial for comprehending the evolution of photosynthetic machinery and potentially for bioengineering applications.

  • What methodologies are most effective for studying Ycf4 protein-protein interactions?

Effective methodologies for studying Ycf4 protein-protein interactions include:

  • In vivo approaches:

    • Split-GFP/BiFC (Bimolecular Fluorescence Complementation) for visualizing interactions in chloroplasts

    • Co-immunoprecipitation followed by mass spectrometry to identify interaction partners

    • Crosslinking coupled with mass spectrometry to capture transient interactions

    • FRET (Förster Resonance Energy Transfer) for studying dynamic interactions

  • In vitro approaches:

    • Pull-down assays using recombinant proteins

    • Surface Plasmon Resonance for measuring binding kinetics

    • Isothermal Titration Calorimetry for thermodynamic parameters of binding

    • Size Exclusion Chromatography combined with Multi-Angle Light Scattering (SEC-MALS) to study complex formation

  • In silico approaches:

    • Protein structure prediction and docking

    • Molecular dynamics simulations to study interaction dynamics

    • Coevolution analysis to predict interacting regions

    • Protein-protein interaction network analysis

Research has demonstrated that Ycf4's C-terminal domain interacts more strongly with photosystem components than its N-terminal region . Specifically, interactions have been observed with:

  • Photosystem I subunits (psaB, psaC, psaH)

  • Light-Harvesting Complex proteins

  • Large and small subunits of RuBisCO

These methodologies, used in combination, provide complementary data that strengthens our understanding of Ycf4's role in photosystem assembly.

Advanced Research Questions

  • How do transcriptomic changes in Ycf4 knockouts contribute to our understanding of chloroplast gene regulation networks?

Transcriptomic analyses of Ycf4 knockouts reveal complex regulatory networks within chloroplasts:

Interestingly, studies of CSK (Chloroplast Sensor Kinase) have shown that this protein links photosynthetic electron transport to gene expression in chloroplasts , suggesting potential parallels or interactions with Ycf4-mediated regulation.

This research demonstrates that Ycf4 may be part of a larger regulatory network connecting photosynthetic activity with gene expression in the chloroplast, extending its role beyond structural assembly of photosystems.

  • What are the implications of cryptic species diversity in Chlorokybus for comparative studies of Ycf4 function?

The discovery of cryptic species diversity within Chlorokybus has significant implications for Ycf4 functional studies:

  • Genetic diversity and functional variation:

    • Phylogenomic analyses have uncovered deep genetic structure within Chlorokybus isolates, leading to the description of four new species

    • Gene expression differences among these species when grown under identical conditions suggest functionally relevant variation

    • This diversity likely extends to Ycf4 function and interaction networks

  • Methodological considerations:

    • Researchers must validate the specific Chlorokybus species/strain used in functional studies

    • Comparative studies should incorporate multiple species to capture functional diversity

    • Experimental designs should account for species-specific responses to environmental conditions

  • Evolutionary insights:

    • The divergences among Chlorokybus species date back approximately 76 Ma, twice as large as those among some flowering plant species

    • This timeframe allows for significant functional divergence while maintaining morphological similarity

    • Studying Ycf4 across these cryptic species may reveal selective pressures on photosystem assembly mechanisms

The genetic distances and gene expression differences among Chlorokybus species are summarized in this partial distance matrix:

SpeciesC. cerffiiC. riethii (NIES-160)C. riethii (UTEX 2591)C. bremeriC. atmophyticus
C. cerffii-0.05730.06190.07810.0690
C. riethii (NIES-160)0.0621-0.01330.06460.0507
C. riethii (UTEX 2591)0.06770.0135-0.06480.0501
C. bremeri0.08740.07100.0713-0.0424
C. atmophyticus0.07620.05430.05360.0452-

This cryptic diversity must be considered when designing experiments and interpreting results related to Ycf4 function in Chlorokybus .

  • How can structural biology approaches be applied to understand the mechanism of Ycf4-mediated photosystem assembly?

Advanced structural biology approaches can significantly enhance our understanding of Ycf4-mediated photosystem assembly:

  • Cryo-electron microscopy (Cryo-EM):

    • High-resolution structure determination of Ycf4 alone and in complex with PSI components

    • Visualization of assembly intermediates to map the assembly pathway

    • Time-resolved studies to capture dynamic assembly processes

    • Sample preparation would involve isolation of native or recombinant Ycf4-PSI complexes, vitrification, and imaging

  • X-ray crystallography:

    • Determination of atomic-resolution structures of Ycf4 domains

    • Co-crystallization with interacting partners to map binding interfaces

    • Phase determination using methods such as molecular replacement or experimental phasing

    • Requires production of highly purified, homogeneous protein samples

  • Integrative structural approaches:

    • Small-angle X-ray scattering (SAXS) for low-resolution envelope determination

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction surfaces

    • Crosslinking mass spectrometry (XL-MS) to identify proximity relationships

    • Molecular dynamics simulations to study conformational changes during assembly

  • Structural analysis workflow:

    • Expression and purification of recombinant Ycf4 (full-length and domains)

    • Initial characterization using biophysical methods (CD, DLS, SEC-MALS)

    • Structure determination using appropriate methods based on sample properties

    • Validation through mutagenesis and functional assays

These approaches would help address key questions about Ycf4 function:

  • How does Ycf4 recognize and bind PSI components?

  • What conformational changes occur during the assembly process?

  • How does the C-terminal domain contribute to functional specificity?

  • What is the structural basis for species-specific differences in Ycf4 function?

  • What evolutionary insights can be gained from comparing Ycf4 with other photosystem assembly factors across the green lineage?

Comparative analysis of Ycf4 with other photosystem assembly factors across the green lineage provides valuable evolutionary insights:

  • Conservation and divergence patterns:

    • Ycf4 shows remarkable conservation across photosynthetic organisms despite over one billion years of evolution

    • Functional domains show higher conservation than linker regions

    • Comparisons with other assembly factors like Ycf3 reveal common evolutionary constraints

    • Lineage-specific adaptations suggest specialized functions in different photosynthetic contexts

  • Co-evolution with photosystems:

    • The evolution of Ycf4 parallels changes in photosystem complexity

    • Correlation between Ycf4 sequence changes and shifts in photosystem subunit composition

    • Analysis of selection pressures on Ycf4 reveals functional constraints across lineages

  • Genomic context evolution:

    • Changes in Ycf4 gene location within the chloroplast genome across lineages

    • Loss of Ycf4 from chloroplast genomes and transfer to nuclear genomes in some lineages

    • Comparison with two-component signaling systems like CSK that link photosynthesis with chloroplast gene expression

  • Methodological approaches:

    • Ancestral sequence reconstruction to infer evolutionary trajectories

    • Selection analysis to identify sites under positive or purifying selection

    • Synteny analysis to track genomic rearrangements

    • Correlation analyses between Ycf4 evolution and photosystem complexity

These analyses suggest that Ycf4, like the Chloroplast Sensor Kinase (CSK), represents an evolutionarily conserved component of chloroplast function that has persisted through the transition from aquatic algae to land plants, maintaining essential roles in photosynthetic function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.