Recombinant Chlorokybus atmophyticus Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Photosystem II Components and Nomenclature Clarification

Photosystem II (PSII) in chloroplasts consists of core reaction center proteins and light-harvesting complexes. Key apoproteins include:

ProteinFunctionUniProt ID (Chlorokybus atmophyticus)Source
psbB (CP47)Core antenna protein; binds chlorophyll and stabilizes PSII structureNot identified in search results
psbC (CP43)Core antenna protein; binds chlorophyll and interacts with the reaction centerQ19VC6

While psbB (CP47) is well-studied in organisms like Spinacia oleracea (UniProt: P04160) , Chlorokybus atmophyticus’s recombinant psbC (CP43) is the only PSII apoprotein explicitly documented in the provided sources .

Functional Role in Photosystem II

In Chlorokybus atmophyticus, psbC (CP43) plays a structural role in PSII:

  • Chlorophyll Binding: Stabilizes chlorophyll molecules, enabling light absorption and energy transfer.

  • Reaction Center Interaction: Coordinates with D1/D2 proteins (psbA/psbD) to form the PSII core .

  • Assembly Regulation: Studies in Synechocystis suggest that CP47 mutants exhibit impaired PSII assembly, underscoring its importance .

Comparative Insights from Streptophyte Algae

Chlorokybus atmophyticus belongs to the Chlorokybophyceae, an early-diverging lineage of streptophytes. Its PSII components share evolutionary conservation with other streptophytes:

OrganismPSII ProteinKey Feature
Chlorokybus atmophyticuspsbC (CP43)His-tagged recombinant protein; subaerial adaptation
Mesostigma viridepsbB/psbCShared chloroplast genomic structure with Chlorokybus, forming a basal streptophyte clade
Spinacia oleraceapsbB (CP47)Spinach model system; UniProt P04160

Research Gaps and Future Directions

  1. psbB in Chlorokybus atmophyticus: No published data on psbB (CP47) exists for this species. Further genomic or transcriptomic studies are needed to confirm its presence.

  2. Functional Studies: Biochemical assays (e.g., chlorophyll binding, PSII activity) for recombinant psbC are lacking in the literature.

  3. Evolutionary Context: Phylogenetic analyses of streptophyte PSII proteins could clarify the evolutionary trajectory of psbB/psbC divergence .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice packaging, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Chlorokybus atmophyticus (Soil alga)
Target Names
psbB
Target Protein Sequence
MGLPWFRVHTVVLNDPGRLISVHLMHTALVSGWAGSMAFYELAVFDPSDPVLNPMWRQGM FVLPFMTRLGITKSWGGWNISGESISDPGLWSYEGVAATHIVLSGLLFLASIWHWVYWDL ELFRDPRTGKPALDLPKIFGIHLFLSGLLCFGFGAFHVTGLFGPGIWVSDPYGITGRVQP VAPAWGAEGFDPFNPGGIASHHIAAGILGILAGLFHLTVRPPFRLYKALRMGNIETVLSS SIAAVFWAAFVVAGTMWYGSAATPIELFGPTRYQWDLGFFQQEIEKRVQASLAGGASLSE AWSSIPEKLAFYDYIGNNPAKGGLFRAGPMNNGDGIAAGWLGHAVFKDKEGRELFVRRMP TFFETFPVLLLDKDGVVKADVPFRRAESKYSVEQVGVTVTFYGGELDGVTFKDPATVKKY ARRAQLGEVFEFDRARLKSDGVFRSSPRGWFTFGHLCFALLFFFGHIWHGARTIFRDVFA GIDPDLDEQVEFGAYQKLGDPSTRKQAV
Uniprot No.

Target Background

Function
CP47 (Photosystem II CP47 chlorophyll apoprotein) is a crucial component of the core complex in photosystem II (PSII). It binds chlorophyll and plays a vital role in catalyzing the primary light-induced photochemical processes of PSII. PSII, a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient that subsequently drives ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the significance of studying the psbB gene from Chlorokybus atmophyticus?

Chlorokybus atmophyticus holds a key phylogenetic position as part of the Chlorokybophyceae, which together with Spirotaenia spp. and Mesostigmatophyceae form the sister lineage to all other streptophytes . The psbB gene encodes the CP-47 protein, which is essential for Photosystem II function . Studying this gene in C. atmophyticus provides valuable insights into the evolution of photosynthetic machinery during the transition from aquatic algae to land plants.

Recent phylogenomic analyses have uncovered substantial diversity within Chlorokybus isolates, with genetic distances often more than twice those recovered among different Arabidopsis species . This genetic diversity must be considered when studying genes like psbB, as there may be significant variation between what were previously considered members of the same species.

How conserved is the psbB gene sequence across photosynthetic organisms?

The psbB gene shows considerable sequence conservation across photosynthetic organisms, though with notable differences. In comparable studies with cyanobacteria, the psbB gene from Synechocystis 6803 showed 68% homology at the DNA level with that from spinach, while the predicted amino acid sequence exhibited 76% homology . This higher protein sequence conservation suggests evolutionary pressure to maintain functional domains of the CP-47 protein despite variations in nucleotide sequence.

For Chlorokybus specifically, we must consider the recently discovered genetic diversity within this genus. Phylogenomic analyses have revealed that divergences within Chlorokybus could be as old as 76 million years (95% HPD interval: 54–102 Ma) . This suggests that psbB sequences could vary significantly between different Chlorokybus species, potentially reflecting adaptations to different environmental conditions.

What is known about the structure and function of the CP-47 protein in Photosystem II?

The CP-47 protein serves as a core antenna protein in Photosystem II. Analysis of CP-47 from cyanobacteria has revealed hydropathy patterns that indicate specific membrane folding configurations . These patterns are highly conserved, as demonstrated by the almost indistinguishable hydropathy patterns between Synechocystis and spinach CP-47, indicating the same general folding pattern in the thylakoid membrane in both species .

A particularly important structural feature is the presence of five pairs of histidine residues in CP-47 that are spaced by 13 or 14 amino acids and located in hydrophobic regions of the protein . These histidine residues may be involved in chlorophyll binding, a critical function for light-harvesting and energy transfer within Photosystem II.

Functional studies have demonstrated that interruption of the psbB gene results in a complete loss of Photosystem II activity . This indicates that an intact CP-47 is absolutely required for a functional Photosystem II complex, though it does not necessarily confirm that this protein houses the reaction center.

What expression systems are most suitable for recombinant production of Chlorokybus atmophyticus CP-47?

When designing an expression system for recombinant CP-47 from Chlorokybus atmophyticus, researchers should consider the following factors:

  • Membrane Protein Challenges: CP-47 is a membrane protein with multiple transmembrane domains as indicated by hydropathy analyses of homologous proteins . Therefore, expression systems capable of properly inserting membrane proteins, such as specialized strains of E. coli (C41(DE3), C43(DE3)), yeast (Pichia pastoris), or insect cell systems, are recommended.

  • Chlorophyll Incorporation: Since CP-47 binds chlorophyll molecules, expression in photosynthetic organisms (such as cyanobacteria or green algae) may be necessary for proper folding and cofactor incorporation. The histidine residues spaced by 13-14 amino acids in hydrophobic regions are likely involved in chlorophyll binding .

  • Species Selection: Given the significant genetic diversity within Chlorokybus isolates , researchers should carefully consider which species/strain to use as the source of the psbB gene. Gene expression differences exist among Chlorokybus species even when grown under identical conditions, which might reflect different cell physiologies .

  • Codon Optimization: Codon optimization for the chosen expression system is advisable, especially considering that Chlorokybus atmophyticus is an early-diverging streptophyte with potentially distinct codon usage patterns.

What purification strategies are effective for recombinant CP-47 protein?

Purification of membrane proteins like CP-47 requires specialized approaches:

  • Detergent Solubilization: Selection of appropriate detergents is critical. Mild detergents like n-dodecyl-β-D-maltoside (DDM), digitonin, or styrene-maleic acid copolymers (SMA) are often used for photosynthetic membrane proteins to maintain native structure.

  • Affinity Tags: Incorporation of affinity tags (His, FLAG, etc.) to facilitate purification should be designed to minimize interference with protein folding and function. C-terminal tags are often preferable for membrane proteins.

  • Chlorophyll Monitoring: Tracking chlorophyll absorbance (particularly at wavelengths around 675 nm) can serve as a useful method to monitor the presence of properly folded CP-47 during purification.

  • Size Exclusion Chromatography: As a final purification step, SEC can help isolate properly folded protein and distinguish between monomeric and aggregated forms.

  • Functional Verification: Verification of chlorophyll binding through spectroscopic methods should be performed to confirm proper folding and function.

How can researchers verify the proper folding and function of recombinant CP-47?

Verification methods for recombinant CP-47 should include:

  • Spectroscopic Analysis: Characteristic absorption and fluorescence spectra should match those of native CP-47. Properly folded CP-47 with bound chlorophyll will have distinctive spectral properties.

  • Circular Dichroism (CD): CD spectroscopy can confirm proper secondary structure formation.

  • Chlorophyll Binding Assay: Quantification of bound chlorophyll molecules per protein can indicate successful incorporation of pigments.

  • Reconstitution Experiments: Functional verification can be performed by reconstituting the recombinant CP-47 into Photosystem II complexes lacking the native protein (using mutants with interrupted psbB genes) and measuring restoration of photosynthetic activity.

  • Structural Analysis: Cryo-EM or X-ray crystallography can provide detailed structural information to compare with known structures from other species.

How does the CP-47 protein from Chlorokybus atmophyticus compare to homologs from other photosynthetic organisms?

Based on studies of related proteins, we can make the following comparisons:

FeatureCyanobacteria (Synechocystis)Higher Plants (Spinach)Chlorokybus atmophyticus (predicted)
DNA sequence homologyReference68% with Synechocystis Likely intermediate between cyanobacteria and land plants
Protein sequence homologyReference76% with Synechocystis Predicted to show features of both groups due to evolutionary position
Hydropathy patternSpecific pattern establishedAlmost indistinguishable from Synechocystis Likely similar due to functional constraints
Histidine pairsFive pairs spaced by 13-14 amino acids Five pairs in similar positions Predicted to maintain this conserved feature
Evolutionary ageAncientRecentIntermediate; part of lineage that diverged ~76 Ma

The comparative analysis of CP-47 across these organisms is particularly valuable because Chlorokybus represents an early-diverging streptophyte lineage, providing insights into the evolution of photosynthetic machinery during the transition to land plants. The recent discovery of significant genetic diversity within Chlorokybus suggests that CP-47 sequences may vary among the newly described species, potentially reflecting different physiological adaptations .

What unique adaptations might be present in the CP-47 protein from Chlorokybus atmophyticus?

Chlorokybus atmophyticus is adapted to subaerial/terrestrial environments , which may be reflected in its photosynthetic proteins including CP-47. Potential adaptations could include:

  • Desiccation Resistance: Modifications that allow the protein to maintain structure and function during periods of water limitation.

  • Light Harvesting Optimization: Adaptations for the light conditions typical of subaerial/terrestrial habitats, which differ from fully aquatic environments.

  • Temperature Stability: Enhanced thermal stability compared to aquatic algal homologs, as terrestrial environments often experience greater temperature fluctuations.

  • Species-Specific Variations: The recently uncovered genetic diversity within Chlorokybus suggests that CP-47 may have evolved distinct features in different species to adapt to their specific environments.

Gene expression differences among Chlorokybus species even when grown under identical conditions indicate that there may be constitutive variations in how these organisms regulate their photosynthetic machinery, which could be reflected in structural or functional adaptations of the CP-47 protein.

How can site-directed mutagenesis of recombinant CP-47 illuminate structure-function relationships?

Site-directed mutagenesis of the recombinant CP-47 protein from Chlorokybus atmophyticus presents a powerful approach to understanding structure-function relationships:

  • Histidine Residue Modification: The five pairs of histidine residues spaced by 13-14 amino acids in hydrophobic regions are prime targets for mutagenesis as they are likely involved in chlorophyll binding . Systematic replacement of these histidines could reveal their individual contributions to chlorophyll coordination and positioning.

  • Comparative Mutational Analysis: Creating the same mutations in CP-47 from different Chlorokybus species (given the newly discovered diversity) could reveal species-specific functional adaptations.

  • Domain Swapping: Exchanging domains between CP-47 proteins from Chlorokybus and other organisms (cyanobacteria, land plants) could illuminate the evolutionary trajectory of this protein and identify regions responsible for specific functions.

  • Assessing Impact on Photosystem II Assembly: Introducing mutations that target interfaces with other Photosystem II proteins could help map the interaction network within the complex. This approach can utilize the observation that interruption of the psbB gene results in complete loss of Photosystem II activity .

  • Environmental Adaptation Studies: Given the subaerial/terrestrial adaptation of Chlorokybus , mutations focusing on regions that might be involved in desiccation or temperature tolerance could reveal how this protein adapted during the colonization of land.

What insights can transcriptomic analysis provide about psbB expression in different Chlorokybus species?

Transcriptomic analysis of psbB expression across different Chlorokybus species can yield significant insights:

  • Species-Specific Expression Patterns: Recent research has revealed marked differences in steady-state gene expression levels among different Chlorokybus isolates even when grown under identical conditions . Analysis of psbB expression specifically could reveal how these species differentially regulate their photosynthetic machinery.

  • Environmental Response Variations: Comparing psbB expression under different environmental conditions (light intensity, temperature, desiccation) across species could illuminate how these closely related but distinct species have evolved different regulatory mechanisms.

  • Correlation with Physiological Differences: The clustering of expression values has been shown to mirror species phylogeny in Chlorokybus . Correlating psbB expression with photosynthetic efficiency measurements could reveal functional consequences of these expression differences.

  • Co-expression Networks: Identifying genes co-expressed with psbB in different species could reveal species-specific regulatory networks governing photosynthesis.

  • Evolutionary Implications: Given that divergences within Chlorokybus could be as old as 76 Ma , transcriptomic analysis of psbB could provide insights into the evolution of photosynthetic gene regulation during this substantial time period.

What are the challenges in crystallizing recombinant CP-47 for structural studies?

Crystallization of membrane proteins like CP-47 presents numerous challenges:

  • Detergent Selection: Finding the optimal detergent that maintains protein stability while allowing crystal contacts is critical. Different detergents should be systematically screened, including newer amphipols and nanodiscs.

  • Lipid Requirements: CP-47 may require specific lipids for structural integrity. Lipid composition optimization or lipidic cubic phase crystallization methods may be necessary.

  • Protein Stability: The protein must remain stable in solution long enough for crystal formation. The presence of bound chlorophyll molecules adds complexity, as these cofactors must remain properly associated with the protein.

  • Homogeneity: Ensuring a homogeneous protein population is crucial. Size-exclusion chromatography and light scattering techniques should be employed to verify monodispersity.

  • Species Selection: Given the diversity within Chlorokybus , screening CP-47 from different species may increase chances of success, as some variants may be more amenable to crystallization.

  • Alternative Approaches: If crystallization proves intractable, researchers should consider cryo-electron microscopy as an alternative structural determination method, particularly as part of larger Photosystem II complexes.

How can researchers address low expression yields of recombinant CP-47?

Low expression yields are a common challenge when working with complex membrane proteins like CP-47. Researchers can implement several strategies to improve expression:

  • Expression System Optimization:

    • Try different expression hosts (E. coli, yeast, insect cells, cyanobacteria)

    • Test specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3))

    • Consider homologous expression in a photosynthetic organism

  • Genetic Modifications:

    • Codon optimization for the expression host

    • Use of fusion partners to enhance solubility (MBP, SUMO, etc.)

    • Creation of chimeric constructs with well-expressed homologs

  • Growth Conditions:

    • Lower induction temperature (16-20°C)

    • Extended, slow induction with lower inducer concentrations

    • Supplementation with chlorophyll precursors if using photosynthetic expression hosts

  • Protein Engineering:

    • Removal of flexible regions that may impede proper folding

    • Testing different truncation constructs

    • Consider expressing individual domains separately

  • Species Selection:

    • Given the genetic diversity within Chlorokybus , testing psbB genes from different species/strains might yield better expression results, as some variants may be more amenable to heterologous expression.

What strategies can resolve protein misfolding issues with recombinant CP-47?

Addressing misfolding of recombinant CP-47 requires a multifaceted approach:

  • Chaperone Co-expression:

    • Co-express molecular chaperones specific to membrane protein folding

    • For photosynthetic proteins, consider co-expressing specialized chloroplast chaperones

  • Membrane Mimetics:

    • Optimize detergent type, concentration, and exchange protocols

    • Explore alternative membrane mimetics (nanodiscs, amphipols, SMALPs)

    • Consider native membrane extraction approaches

  • Cofactor Incorporation:

    • Ensure availability of chlorophyll during expression and purification

    • The histidine residues in hydrophobic regions are likely involved in chlorophyll binding and proper chlorophyll incorporation may be necessary for correct folding

  • Post-translational Modifications:

    • Verify if any post-translational modifications are required for proper folding

    • Consider expression systems capable of performing necessary modifications

  • Reconstitution Approaches:

    • Attempt refolding from inclusion bodies under controlled conditions

    • Gradual detergent exchange during purification

  • Screening Multiple Species:

    • Test CP-47 from different Chlorokybus species , as some may inherently fold better in recombinant systems

How can researchers validate that recombinant CP-47 maintains native structural and functional properties?

Comprehensive validation requires multiple complementary approaches:

  • Spectroscopic Analysis:

    • Absorption spectra to confirm proper chlorophyll incorporation and environment

    • Circular dichroism to verify secondary structure

    • Fluorescence spectroscopy to assess chlorophyll-protein interactions

  • Functional Assays:

    • Chlorophyll binding quantification

    • Reconstitution into Photosystem II preparations lacking CP-47

    • Energy transfer efficiency measurements

  • Structural Verification:

    • Limited proteolysis patterns compared to native protein

    • Antibody recognition profiles with conformational antibodies

    • Thermal stability assays to compare with native protein

  • Interaction Studies:

    • Binding assays with known interaction partners from Photosystem II

    • Cross-linking studies to verify proximity of interaction sites

  • Comparative Analysis:

    • Side-by-side comparison with CP-47 isolated from natural sources

    • Comparison of properties with well-characterized homologs from other species

  • Genetic Complementation:

    • Test if the recombinant protein can complement a psbB knockout mutant, based on the observation that interruption of the psbB gene results in loss of Photosystem II activity

How might understanding CP-47 from Chlorokybus atmophyticus contribute to evolutionary insights about photosynthesis?

Chlorokybus atmophyticus holds a key phylogenetic position as part of the earliest-diverging streptophyte lineage , making its photosynthetic proteins particularly valuable for evolutionary studies:

  • Transitional Features: Analysis of CP-47 from Chlorokybus could reveal transitional features between cyanobacterial ancestors and advanced land plants, helping reconstruct the evolutionary trajectory of photosynthetic machinery.

  • Cryptic Diversity Implications: The recently uncovered deep genetic structure within Chlorokybus isolates provides an opportunity to study how CP-47 has evolved within a morphologically conserved but genetically diverse lineage over approximately 76 million years.

  • Adaptation Signatures: Comparing CP-47 sequences across Chlorokybus species could reveal adaptation signatures related to the transition to subaerial/terrestrial environments, a key step in plant terrestrialization.

  • Ancestral Sequence Reconstruction: Using CP-47 sequences from various Chlorokybus species alongside other streptophytes allows for more accurate ancestral sequence reconstruction of this important protein at key evolutionary nodes.

  • Molecular Clock Applications: The dated divergences within Chlorokybus (ranging from 24 to 76 Ma) can provide calibration points for molecular clock studies of photosynthetic proteins.

  • Stress Response Evolution: Given the observed gene expression differences among Chlorokybus species , comparative studies of CP-47 regulation could illuminate the evolution of photosynthetic stress responses during plant terrestrialization.

What technological advances might improve the study of recombinant photosynthetic proteins like CP-47?

Several emerging technologies hold promise for advancing research on recombinant CP-47:

  • Cell-Free Expression Systems: Specialized cell-free systems incorporating chloroplast components could allow for more controlled production of properly folded CP-47 with appropriate cofactor incorporation.

  • Nanoscale Structural Methods: Advances in cryo-electron microscopy and tomography enable structural determination of membrane proteins without crystallization, potentially revolutionizing our understanding of CP-47 structure.

  • Native Mass Spectrometry: Improvements in native MS techniques allow for analysis of intact membrane protein complexes with bound pigments, providing insights into stoichiometry and complex assembly.

  • Synthetic Biology Approaches: Designer expression systems specifically tailored for photosynthetic proteins could overcome current limitations in heterologous expression.

  • Single-Molecule Techniques: Advanced single-molecule fluorescence methods can reveal dynamic aspects of CP-47 function that are masked in ensemble measurements.

  • Computational Methods: Improved protein structure prediction algorithms, particularly those incorporating co-evolutionary information, may enable more accurate modeling of CP-47 structure and dynamics.

  • Genome Editing in Chlorokybus: Development of transformation and genome editing systems for Chlorokybus species would allow direct manipulation of the psbB gene in its native context, enabling in vivo functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.