Recombinant Chlorokybus atmophyticus Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant psbD is synthesized via codon-optimized expression in E. coli, followed by affinity chromatography using the His-tag. Critical parameters include:

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -20°C/-80°C .

  • Reconstitution: Requires deionized water, with glycerol (5–50%) recommended for long-term stability .

Functional and Evolutionary Insights

  • Role in PSII: PsbD forms the reaction center core with D1, facilitating water oxidation and oxygen evolution . Mutations in psbD mRNA reduce PSII stability and impair electron transport in plants and algae .

  • Regulation: Transcription of psbD in chloroplasts is light-dependent and mediated by sigma factors like AtSig5 in Arabidopsis, which activates the psbD blue light-responsive promoter (BLRP) .

  • Evolutionary Conservation: PsbD is highly conserved across photosynthetic organisms. Phylogenetic studies using psbD sequences resolve monophyletic clades in Chlorophyceae and streptophyte algae, underscoring its role in evolutionary adaptations .

Research Applications

  • Structural Studies: Used to investigate PSII assembly and photodamage repair mechanisms .

  • Biotechnological Tools: Serves as a template for engineering stress-tolerant photosynthetic systems .

  • Phylogenetics: Helps delineate evolutionary relationships among chlorophytes and streptophytes .

Comparison with Homologs

The Chlorokybus psbD shares functional parallels with homologs in other species but exhibits unique structural features:

OrganismKey Differences
Synechocystis PCC6803PsbD synthesis limits PSII biogenesis
Chlamydomonas reinhardtiiPsbD translation efficiency impacts PSII accumulation
Phalaenopsis aphroditeShorter length (353 aa), distinct N-terminal residues

Challenges and Innovations

  • Expression Optimization: High-light conditions and removal of competing endogenous PSII subunits (e.g., D1) enhance recombinant psbD yields .

  • Selective Mutations: Variants with modified SD/anti-SD sequences or promoter elements refine translation efficiency and stability .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. To prevent degradation, avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your product.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Chlorokybus atmophyticus (Soil alga)
Target Names
psbD
Target Protein Sequence
MTISIEKSVKKTQPSLFDLCDDWLKRDRFVFVGWSGLLLFPCAYLALGGWFTGTTFVTSW YSHGLASSYLEGCNFLTAAVSTPPNSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHG AFALIGFMLRQFEIARAVKLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAGI FRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPT QSEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVLGLALNLRAYDF VSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLVFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O. This process generates O(2) and a proton gradient, which is subsequently used for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors. D2 plays a crucial role in the assembly of a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the significance of studying the D2 protein from Chlorokybus atmophyticus specifically?

Chlorokybus atmophyticus represents an important evolutionary position as an early-diverging charophyte alga. Studying its D2 protein provides insights into the evolution of photosynthetic machinery between cyanobacteria and land plants. Notably, genome sequence analysis indicates that Chlorokybus atmophyticus has distinct regulatory features, as it does not seem to encode certain response regulators found in other photosynthetic organisms . This makes its D2 protein particularly interesting for comparative studies of PSII structure and function across different evolutionary lineages.

Research on Chlorokybus atmophyticus psbD contributes to our understanding of how photosynthetic apparatus regulation has evolved, with implications for both basic science and biotechnological applications in photosynthesis engineering.

How does the D2 protein function within the PSII complex?

The D2 protein forms one of the two central subunits (along with D1) of the PSII reaction center. In photosynthetic organisms, D2 participates in several critical functions:

  • Forms an essential part of the electron transport chain within PSII

  • Binds cofactors necessary for photochemical reactions, including chlorophylls, pheophytins, and quinones

  • Assembles with other proteins to form functional modules during PSII biogenesis

During PSII assembly, D2 first forms modules (D2 mod) with adjacent small PSII proteins and auxiliary factors. Research has shown that D2 mod contains both the PsbE and PsbF subunits of cytochrome b559 and CyanoP . These D2 modules then combine with D1 modules to form the PSII reaction center assembly complex (RCII) . This sequential assembly is critical for the proper functioning of the photosynthetic apparatus.

What genomic features characterize the psbD gene in Chlorokybus atmophyticus?

The psbD gene in Chlorokybus atmophyticus has several notable features:

  • It appears to be under specific regulatory control, though the complete regulatory mechanisms remain to be fully characterized

  • Unlike higher plants where psbD is often present in multiple copies, genomic studies suggest Chlorokybus atmophyticus may have a simplified gene organization

  • The regulatory elements of the psbD gene in Chlorokybus atmophyticus lack certain response regulators found in more evolutionarily advanced photosynthetic organisms

These genomic features make the psbD gene from Chlorokybus atmophyticus an interesting subject for evolutionary studies examining the development of regulatory mechanisms in photosynthetic organisms.

What are the optimal conditions for recombinant expression of Chlorokybus atmophyticus D2 protein?

For successful recombinant expression of Chlorokybus atmophyticus D2 protein, researchers should consider the following methodological approach:

Expression System Selection:

  • Bacterial systems: E. coli BL21(DE3) strains are commonly used for initial attempts, though yield may be limited due to the hydrophobic nature of D2

  • Cyanobacterial systems: Consider expression in Synechocystis sp. PCC 6803 with His-tagged constructs as demonstrated for other D2 proteins

  • Eukaryotic systems: Chlamydomonas reinhardtii chloroplast transformation for expression in a native-like environment

Protocol Optimization:

  • Clone the Chlorokybus atmophyticus psbD gene into an appropriate expression vector (e.g., pGEX system for GST fusion as shown in related research)

  • Transform into the chosen expression host

  • Induce expression under controlled conditions (typically low temperature, 18-22°C, to aid proper folding)

  • Extract using specialized membrane protein purification techniques with appropriate detergents (β-DDM or n-dodecyl-β-D-maltoside at 0.5-1%)

  • Purify using affinity chromatography based on introduced tags (His-tags have been successfully used for other D2 proteins)

The hydrophobic nature of D2 protein presents significant challenges for recombinant expression. Success often requires extensive optimization of solubilization conditions and potentially co-expression with chaperones or other PSII components.

How can researchers verify the proper folding and functionality of recombinant Chlorokybus atmophyticus D2 protein?

Verification of properly folded and functional recombinant D2 protein requires multiple complementary approaches:

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy to analyze secondary structure content

  • Size exclusion chromatography to verify oligomeric state

  • Limited proteolysis to assess proper folding via digestion pattern

Functional Assays:

  • Pigment binding assessment: Measure chlorophyll and pheophytin association through absorption spectroscopy

  • Assembly competence: Test ability to form RCII complexes with purified D1 and other PSII components

  • Charge separation activity: Measure light-induced electron transfer capabilities using spectroscopic methods

Biochemical Verification:

  • Immunological detection using anti-D2 antibodies (such as those available commercially for related species)

  • Mass spectrometry to confirm protein identity and post-translational modifications

  • Protein-protein interaction studies with known D2 partners like cytochrome b559 subunits

Based on research with other photosynthetic systems, successful recombinant D2 protein should demonstrate specific spectral properties and the capacity to participate in RCII assembly when combined with appropriate partner proteins.

What methods are most effective for studying D2 protein interactions within PSII assembly complexes?

The study of D2 protein interactions within PSII assembly complexes can be approached through several complementary methods:

Isolation of Assembly Intermediates:

  • Affinity purification using tagged D2 protein (His-tagged constructs have been successfully used)

  • Clear native (CN) electrophoresis followed by SDS-PAGE in the second dimension to separate and identify assembly complexes

  • Size exclusion chromatography to separate assembly intermediates based on molecular weight

Protein-Protein Interaction Analysis:

  • Co-immunoprecipitation with antibodies against D2 or its partner proteins

  • Cross-linking mass spectrometry to identify interaction sites

  • Förster resonance energy transfer (FRET) to detect proximity between fluorescently labeled components

  • Yeast two-hybrid or bacterial two-hybrid screening for binary interactions

Functional Relationship Characterization:

  • Site-directed mutagenesis of potential interaction domains

  • In vitro reconstitution of minimal complexes from purified components

  • Time-resolved spectroscopy to assess electron transfer between components

Studies with cyanobacterial systems have demonstrated that D2 modules (D2 mod) contain cytochrome b559 (PsbE and PsbF subunits), and potentially other components like PsbY, Phb1, Phb3, FtsH2/FtsH3, CyanoP, and Slr1470 . Similar approaches could be applied to study Chlorokybus atmophyticus D2 protein interactions.

How should researchers address pigment binding variations when comparing D2 proteins from different species?

When comparing pigment binding properties of D2 proteins across species, researchers face several analytical challenges that require methodological solutions:

Standardization Approaches:

  • Normalize pigment content to protein concentration using accurate protein quantification methods

  • Use molar ratios rather than absolute quantities when comparing across species

  • Develop species-specific extinction coefficients for accurate spectrophotometric analysis

Comparative Analysis Framework:

ParameterMeasurement MethodNormalization ApproachTypical Value Range
Chlorophyll bindingAbsorption spectroscopy, HPLCMoles Chl per mole D23-6 Chl molecules
Pheophytin bindingAbsorption spectroscopyMoles Pheo per mole D21-2 Pheo molecules
β-carotene associationHPLC analysisMoles carotene per mole D21-2 carotene molecules
Spectral propertiesAbsorption peaksPeak ratiosSpecies-dependent

Interpretation Guidelines:

  • Consider evolutionary context when interpreting differences

  • Assess whether variations correlate with functional differences in photosynthetic efficiency

  • Evaluate the impact of experimental conditions on pigment binding (detergent effects, purification methods)

Research indicates that stable chlorophyll binding varies between D1 and D2 modules, with chlorophyll detected in D1 mod but not D2 mod in isolation . This suggests that RCII formation is crucial for stable binding of most chlorophylls and pheophytins. Similar patterns might exist in Chlorokybus atmophyticus, but with species-specific variations that require careful comparative analysis.

What are the common pitfalls in interpreting D2 protein expression and assembly data?

Researchers studying D2 protein expression and assembly should be aware of several potential pitfalls in data interpretation:

Expression Analysis Challenges:

  • Antibody Cross-Reactivity: Commercial antibodies may have varied specificity for D2 from different species. Solution: Validate antibody specificity with recombinant proteins and include appropriate controls.

  • Extraction Efficiency Variations: Membrane protein extraction methods may have different efficiencies across samples. Solution: Use quantitative extraction methods optimized for membrane proteins and include recovery controls.

  • Normalization Issues: Different reference genes or proteins may behave differently across experimental conditions. Solution: Use multiple reference genes/proteins and validate stability under experimental conditions.

Assembly Analysis Pitfalls:

  • Artificial Complexes Formation: Detergent solubilization can create non-native protein associations. Solution: Use multiple detergent types and concentrations to verify consistent complex formation.

  • Environmental Sensitivity: PSII complexes are sensitive to light, temperature, and redox conditions. Solution: Standardize all environmental parameters during sample preparation and analysis.

  • Subunit Stoichiometry Misinterpretation: Under certain conditions (e.g., high light), subunit numbers may not match functional photosystem counts . Solution: Combine biochemical quantification with functional assays.

Technical Artifacts:

  • Post-extraction Degradation: D2 protein can degrade during analysis. Solution: Add protease inhibitors and minimize sample handling time.

  • Species-Specific Assembly Patterns: Assembly pathways may differ between species. Solution: Avoid direct extrapolation of assembly models between distant species without verification.

How do researchers resolve contradictory data between in vitro and in vivo studies of D2 protein function?

Resolving contradictions between in vitro and in vivo D2 protein functional studies requires systematic methodological approaches:

Reconciliation Framework:

  • Parameter Alignment: Identify specific parameters that differ between in vitro and in vivo conditions (pH, ion concentrations, redox potential).

  • Intermediate Systems: Utilize reconstituted liposomes or nanodiscs as intermediate complexity systems.

  • Directed Mutagenesis: Create mutants that specifically test hypotheses about functional discrepancies.

Methodological Integration Approaches:

  • Progressive Complexity Testing: Test hypotheses across systems of increasing complexity:

    • Purified protein → Membrane reconstitution → Cell-free expression systems → Intact cells

  • Parallel In Vitro/In Vivo Analysis: Apply the same analytical techniques to both systems where possible.

  • Mathematical Modeling: Develop models that account for differences in environmental parameters.

Common Sources of Discrepancy and Solutions:

Discrepancy TypeCommon CauseResolution Strategy
Electron transfer ratesMissing components in vitroSupplement with potential missing cofactors; verify complete assembly
Protein stabilityDifferent lipid environmentReconstitute in native-like lipid compositions
Spectral propertiesAltered pigment bindingCompare pigment content; adjust solvent conditions
Assembly patternsChaperone absenceAdd or express relevant assembly factors

Research shows that D2 protein function is highly dependent on proper complex formation with other PSII components. In vivo, D2 is integrated into modules with cytochrome b559 and other factors before RCII formation , which may not be fully replicated in simplified in vitro systems.

How might post-translational modifications of Chlorokybus atmophyticus D2 protein differ from those in other photosynthetic organisms?

Post-translational modifications (PTMs) of D2 protein are critical for its function, and studying species-specific differences provides evolutionary insights:

Predicted PTM Differences in Chlorokybus atmophyticus:

  • Phosphorylation Sites: Based on evolutionary position, Chlorokybus atmophyticus D2 likely contains some but not all phosphorylation sites found in land plants.

  • Redox-Sensitive Residues: May have unique cysteine positions reflecting its adaptation to specific light environments.

  • N-terminal Processing: Potential differences in transit peptide cleavage sites compared to land plants .

Research Methodology for PTM Characterization:

  • Mass spectrometry analysis of purified D2 protein using:

    • Phosphopeptide enrichment techniques

    • Multiple fragmentation methods (CID, ETD, HCD)

    • Comparative analysis with D2 from other species

  • Site-directed mutagenesis of putative modification sites followed by functional assays

  • In vitro modification assays with kinases, phosphatases, and redox agents

Evolutionary Context Analysis:

  • Alignment of D2 sequences across evolutionary diverse photosynthetic organisms

  • Mapping of conserved vs. species-specific modification sites

  • Correlation of modifications with environmental adaptations

The unique evolutionary position of Chlorokybus atmophyticus makes its D2 PTM pattern potentially informative about the evolution of regulatory mechanisms in photosynthetic organisms. Understanding these differences could provide insights into adaptation mechanisms of photosynthetic machinery.

What role might Chlorokybus atmophyticus D2 protein play in the evolution of two-component signaling systems in chloroplasts?

The evolutionary relationship between D2 protein and two-component signaling systems in chloroplasts represents an advanced research area:

Evolutionary Context:

  • Chlorokybus atmophyticus occupies a pivotal position in the evolution of charophyte algae, which are ancestral to land plants.

  • Two-component signaling systems are important for chloroplast gene regulation in response to environmental cues.

  • Research indicates that Chlorokybus atmophyticus "do not seem to encode response regulators" , suggesting unique regulatory mechanisms.

Research Questions and Approaches:

  • Regulatory Interaction Analysis:

    • Investigate whether psbD gene expression in Chlorokybus atmophyticus responds to chloroplast sensor kinases

    • Perform comparative transcriptomics under varying light conditions

    • Identify potential cis-regulatory elements in the psbD promoter region

  • Signaling Pathway Reconstruction:

    • Identify and characterize potential sensor kinases in Chlorokybus atmophyticus

    • Test phosphotransfer between purified kinase domains and response regulators

    • Compare with known pathways in cyanobacteria and land plants

  • Functional Evolution Study:

    • Create chimeric proteins between Chlorokybus atmophyticus components and those from other species

    • Test complementation in mutants of model organisms

    • Assess coevolution of signaling components and photosystem structure

The psbD gene in various organisms is known to be under regulatory control , but the mechanisms in Chlorokybus atmophyticus may represent evolutionary intermediates that provide insight into the development of chloroplast signaling systems.

How can researchers leverage Chlorokybus atmophyticus D2 protein studies to understand PSII repair mechanisms across evolutionary lineages?

PSII repair mechanisms are essential for maintaining photosynthetic efficiency under stress conditions, and studying D2 from Chlorokybus atmophyticus offers evolutionary insights:

Comparative Framework Development:

  • Establish standardized assays for measuring D2 turnover rates across species

  • Create a database of D2 sequence variations correlated with repair efficiency

  • Develop evolutionary models of PSII repair mechanism development

Methodological Approaches:

  • Photodamage and Recovery Assays:

    • Expose recombinant or native PSII complexes to controlled light stress

    • Monitor D2 degradation kinetics using pulse-chase labeling

    • Quantify repair efficiency through oxygen evolution recovery measurements

  • Repair Component Identification:

    • Identify protease systems involved in Chlorokybus atmophyticus D2 turnover

    • Compare with known systems such as FtsH proteases identified in other organisms

    • Characterize species-specific vs. conserved repair components

  • Stress Response Pathway Analysis:

    • Characterize transcriptional responses of psbD to various stressors

    • Identify regulatory elements controlling stress-induced expression

    • Compare with pathways in cyanobacteria and land plants

Evolutionary Significance Assessment:

  • Map repair mechanism components across photosynthetic lineages

  • Identify key evolutionary transitions in repair system complexity

  • Correlate repair mechanism evolution with environmental adaptations

Research indicates that PSII repair involves specific protease systems, with FtsH protease subunits associated with RCII complexes . Understanding how these systems evolved from cyanobacteria through Chlorokybus atmophyticus to land plants could provide fundamental insights into photosynthetic adaptation.

What are the optimal techniques for quantifying expression levels of recombinant Chlorokybus atmophyticus D2 protein?

Accurate quantification of recombinant D2 protein presents specific challenges due to its hydrophobic nature and integration into membrane complexes:

Protein Extraction and Preparation Methods:

  • Optimize membrane protein extraction using specialized buffers containing:

    • Non-ionic detergents (β-DDM, n-dodecyl-β-D-maltoside)

    • Appropriate salt concentrations (150-300 mM NaCl)

    • Protease inhibitor cocktails to prevent degradation

  • Implement differential centrifugation protocols to separate membrane fractions

Quantification Techniques Comparison:

MethodAdvantagesLimitationsOptimal Application
Western blottingSpecific detection, sensitiveSemi-quantitative, antibody variabilityRelative comparisons across samples
ELISAHighly quantitative, high throughputRequires validated antibodiesAbsolute quantification once calibrated
Mass spectrometryAbsolute quantification, no antibody neededComplex sample preparation, expensivePrecise quantification of multiple proteins
Fluorescence (for GFP fusions)Non-destructive, real-timeMay affect protein functionLocalization and expression monitoring

Standardization Approaches:

  • Use purified recombinant D2 protein (or synthetic peptides) as quantification standards

  • Employ internal reference proteins for normalization

  • Validate quantification across multiple methods

When quantifying expression levels, ratio calculations should be done on a sample-by-sample basis, as these ratios are based on the subunits present, whether they are in the assembled photosystem or not . Under some conditions (e.g., high light), subunit numbers may not match functional photosystems due to biological variations in assembly efficiency .

How can differential promoter usage be effectively analyzed in Chlorokybus atmophyticus psbD expression studies?

Understanding differential promoter usage is critical for characterizing psbD gene regulation in Chlorokybus atmophyticus:

Experimental Approaches:

  • 5' RACE Analysis:

    • Map transcription start sites under different environmental conditions

    • Identify potential alternative promoters

    • Compare with known promoter usage patterns in other species

  • Reporter Gene Assays:

    • Create constructs with different putative promoter regions

    • Test activity in homologous or heterologous expression systems

    • Measure response to environmental stimuli (light quality, intensity)

  • Transcriptional Run-on Assays:

    • Isolated chloroplasts can be used to measure transcription rates of specific genes

    • Compare transcription under different light conditions or redox states

    • Follow protocols similar to those described for run-on transcriptional assays of chloroplast genes

Data Analysis Framework:

  • Identify conserved promoter elements through comparative genomics

  • Quantify relative usage of different promoters using qRT-PCR with specific primers

  • Correlate promoter usage with environmental conditions and developmental stages

Regulatory Network Mapping:

  • Perform ChIP assays to identify proteins binding to different promoter regions

  • Use EMSA to confirm specific protein-DNA interactions

  • Construct regulatory network models based on integrated data

Research on other photosynthetic organisms has shown that psbD gene expression often involves differential promoter usage in response to environmental cues, particularly light quality changes . Understanding these mechanisms in Chlorokybus atmophyticus would provide evolutionary context for the development of photosynthetic gene regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.