Recombinant Chlorokybus atmophyticus Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Overview and Biological Significance

The Recombinant Chlorokybus atmophyticus Photosystem Q(B) Protein (psbA) is a heterologously expressed form of the D1 reaction center protein, a critical component of Photosystem II (PSII) in oxygenic photosynthesis. This protein facilitates electron transport by binding plastoquinone (Q<sub>B</sub>) and is a target for herbicides like atrazine . In Chlorokybus atmophyticus, a soil-dwelling streptophyte alga, the psbA gene encodes a 344-amino acid polypeptide essential for photochemical energy conversion .

Recombinant Production and Purification

The protein is expressed in E. coli with a His-tag for affinity chromatography. Post-purification, it is lyophilized to enhance stability. Key parameters include:

  • Reconstitution: Solubilized in sterile water (0.1–1.0 mg/mL) with optional 5–50% glycerol for long-term storage .

  • Functional Integrity: Retains herbicide-binding capacity and electron transport activity, akin to native D1 proteins in cyanobacteria .

Domain Architecture

  • Transmembrane helices: Five segments anchor the protein to the thylakoid membrane .

  • Q<sub>B</sub>-binding site: Located near the stromal side, involving residues His-215 and Ser-264 .

Comparative Analysis

FeatureChlorokybu psbASynechococcus psbA
Protein Length344 residues360 residues (D1:1/D1:2 isoforms)
IsoformsSingleThree (psbAI, psbAII, psbAIII)
Herbicide SensitivityHigh (atrazine)Variable (light-dependent)

Applications in Research

  1. Herbicide Resistance Studies: Used to analyze binding interactions with triazine-class inhibitors .

  2. Photosystem Assembly: Serves as a model to study D1 integration into PSII complexes, aided by assembly factors like HCF244 and RBD1 .

  3. Evolutionary Biology: Chlorokybus psbA provides insights into early streptophyte adaptations to terrestrial environments .

Research Limitations and Future Directions

  • Structural Data: No high-resolution crystal structure is available for Chlorokybus psbA, though homology models exist based on cyanobacterial D1 .

  • Functional Redundancy: Unlike cyanobacteria with multiple psbA genes, Chlorokybus relies on a single copy, limiting stress-response plasticity .

Key References

  1. Cyanobacterial psbA gene regulation under light stress .

  2. Role of cyclophilin anaCyp40 in photosystem assembly .

  3. Mechanistic studies on psbA translation regulation .

  4. Product specifications for recombinant Chlorokybus psbA .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein with deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Chlorokybus atmophyticus (Soil alga)
Target Names
psbA
Target Protein Sequence
MTATLERRESASLWSRFCDWITSTDNRLYIGWFGVLMIPLLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIVPTSAAIGLHFYPIWEAASLDEWLYNGGPYEMIVLHFL LGVCCYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAAWPVIGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP synthesis. It comprises a core antenna complex responsible for capturing photons, and an electron transfer chain that transforms photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How should recombinant PsbA protein from C. atmophyticus be stored and handled for optimal stability?

For optimal stability and activity, recombinant C. atmophyticus PsbA protein should be stored as a lyophilized powder at -20°C or -80°C upon receipt. When working with the protein, it's important to avoid repeated freeze-thaw cycles as these can significantly compromise protein integrity .

For reconstitution, researchers should:

  • Briefly centrifuge the vial before opening to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as standard practice)

  • Prepare working aliquots and store at 4°C for short-term use (up to one week)

  • Store remaining material at -20°C/-80°C for long-term storage

The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during storage . Working aliquots should be prepared in small volumes to minimize the need for repeated thawing of the entire stock.

What are the taxonomic and evolutionary considerations when studying C. atmophyticus PsbA?

Chlorokybus atmophyticus occupies a significant position in plant evolution as an early-diverging charophytic alga, representing one of the closest algal relatives to land plants. When studying its PsbA protein, several taxonomic and evolutionary considerations are important:

  • Phylogenetic placement: C. atmophyticus belongs to the Chlorokybophyceae, one of the earliest-diverging lineages within the streptophyte algae .

  • Cell wall composition: Unlike other streptophyte algae and land plants, C. atmophyticus has distinct cell wall characteristics, containing pseudo-pectin components that differ significantly from land plant pectins. These include β-D-GlcA-(1→4)-L-Gal disaccharide units and lack of rhamnogalacturonan structures typically found in land plants .

  • Promoter evolution: Interestingly, while several photosystem genes (including psbA) have conserved promoters across most streptophytes, C. atmophyticus lacks the conserved promoter for psaA, suggesting evolutionary divergence in transcriptional regulation .

This unique evolutionary position makes C. atmophyticus PsbA valuable for comparative studies examining the evolution of photosynthetic machinery during the transition from aquatic to terrestrial environments in the plant lineage.

What are the optimal methods for quantifying PsbA protein expression in experimental systems?

For precise quantification of PsbA protein expression, researchers have developed sophisticated mass spectrometry-based approaches that overcome the challenges of high sequence similarity between PsbA variants. The recommended methodology involves:

Reverse phase-LC-electrospray mass ionization-MS/MS (RP-LC-ESI-MS/MS), which enables accurate protein quantification even when sequence identity between protein isoforms is extremely high . This approach allows:

  • Discrimination between highly similar PsbA protein copies that may differ by only a few amino acids

  • Precise correlation between transcript and protein levels

  • Quantitative comparison of PsbA variants under different experimental conditions

The methodology typically involves:

  • Protein extraction under denaturing conditions

  • Tryptic digestion to generate peptide fragments

  • RP-LC separation of peptides

  • ESI-MS/MS analysis with selected reaction monitoring (SRM) for specific peptides

  • Quantification based on unique peptide signatures

This approach has been successfully used to quantify PsbA proteins in cyanobacteria, demonstrating that approximately 70% of PsbA3 could be detected under high light conditions, closely corresponding to transcript levels . Similar techniques could be adapted for C. atmophyticus studies.

How can researchers effectively analyze functional differences between PsbA variants in photosynthetic organisms?

To effectively analyze functional differences between PsbA variants, researchers should employ a multi-technique approach combining both in vivo and in vitro methods:

  • Genetic manipulation approaches:

    • Construction of knock-out mutants to isolate individual PsbA variants

    • Site-directed mutagenesis to examine specific amino acid contributions to function

  • Biophysical characterization methods:

    • Thermoluminescence measurements to detect shifts in redox pair free energy

    • Delayed fluorescence measurements to assess energy transfer dynamics

    • Flash-induced fluorescence decay analysis for electron transfer kinetics

    • Prompt fluorescence measurements for Q(A)-Q(B) electron transfer assessment

  • Photoinhibition studies:

    • High light stress experiments to assess photoprotective capacity

    • Recovery kinetics measurements following photodamage

    • ROS production monitoring during light stress conditions

In previous studies with cyanobacterial PsbA variants, these techniques revealed that PsbA3-containing complexes exhibited a shift in the redox potential of pheophytin toward more positive values compared to PsbA1, providing better protection against photoinhibition through enhanced harmless dissipation of excess energy . Similar approaches would be valuable for characterizing potential functional differences in C. atmophyticus PsbA.

What are the challenges in expressing and purifying functional C. atmophyticus PsbA for structural studies?

Expressing and purifying functional C. atmophyticus PsbA for structural studies presents several significant challenges:

  • Membrane protein expression barriers:

    • PsbA is a highly hydrophobic integral membrane protein with multiple transmembrane domains

    • Expression in heterologous systems often results in inclusion body formation

    • Proper folding requires specific lipid environments and cofactor incorporation

  • Cofactor incorporation:

    • Functional PsbA requires precise incorporation of numerous cofactors including chlorophylls, pheophytins, plastoquinones, and the manganese cluster

    • Reconstitution of these cofactors in recombinant systems is technically challenging

  • Purification considerations:

    • Detergent selection is critical for maintaining native structure during extraction

    • Protein-detergent complexes must be carefully optimized for structural studies

    • His-tagged constructs facilitate initial purification but may affect structure or function

  • Stability challenges:

    • PsbA is susceptible to photodamage during handling

    • The protein requires specific buffer conditions to maintain stability

    • Avoiding aggregation during concentration steps is particularly difficult

Mitigation strategies include performing all procedures under dim green light, incorporating stabilizing agents like glycerol and trehalose, and using mild detergents during the purification process . For structural studies, cryo-EM approaches may be preferable to crystallography, as they can be performed with lower protein concentrations and in more native-like environments.

How does the promoter structure of the psbA gene in C. atmophyticus compare to other photosynthetic organisms?

The promoter structure of the psbA gene shows interesting evolutionary patterns across photosynthetic organisms, with C. atmophyticus exhibiting some notable differences:

  • Conserved promoters in most streptophytes:
    The psbA gene promoter is widely conserved across most land plants and streptophyte algae, being one of only five genes (along with psaA, psbB, psbE, and rbcL) that maintain highly conserved bacterial-type promoters in plastids .

  • C. atmophyticus exceptions:
    Unlike the pattern seen with psbA, C. atmophyticus lacks the conserved promoter for the psaA gene that is present in most other streptophytes. This indicates potential evolutionary divergence in promoter structures within this early-branching charophytic alga .

  • Promoter structure features:
    The typical psbA promoter in streptophytes features:

    • A conserved "-10" box with consensus TATAAT

    • A "-35" box with typical bacterial-type features

    • Potential light-responsive elements that regulate expression

  • Evolutionary implications:
    The conservation of certain promoters, including psbA, may reflect their critical role in maintaining high expression levels of essential photosynthetic components. The psbA gene must be highly expressed to encode the D1 protein, which undergoes rapid turnover due to photodamage .

This comparison highlights how C. atmophyticus may represent a transitional state in the evolution of transcriptional regulation between ancestral green algae and modern land plants, with some conserved elements and other divergent features.

What functional domains and critical residues have been identified in the C. atmophyticus PsbA protein?

Based on sequence analysis and comparison with other PsbA proteins, several functional domains and critical residues can be identified in the C. atmophyticus PsbA protein:

Domain/RegionAmino Acid PositionFunction
Transmembrane helicesMultiple segments throughout sequenceMembrane anchoring and cofactor coordination
D1-D2 interaction interfacePrimarily C-terminal regionCritical for dimerization with D2 protein
QB binding pocket~211-290Binding site for plastoquinone electron acceptor
Mn4CaO5 cluster binding~170-344Water oxidation center coordination
C-terminal processing siteNear C-terminusRequired for proper maturation

Critical residues likely include:

  • Histidine residues involved in chlorophyll and pheophytin coordination

  • Aspartate and glutamate residues involved in the manganese cluster coordination

  • Tyrosine residues (particularly D1-Tyr161) involved in the electron transport chain

  • Serine and threonine residues that may be phosphorylation targets involved in the regulation of D1 turnover

The amino acid sequence of C. atmophyticus PsbA (Q19VC4) contains regions highly similar to other D1 proteins that are known to coordinate cofactors essential for photosynthetic electron transport . These functional elements are largely conserved across photosynthetic organisms, reflecting the fundamental importance of the D1 protein in photosystem II function.

How does C. atmophyticus PsbA sequence and structure compare to those from other photosynthetic lineages?

The C. atmophyticus PsbA protein represents an important evolutionary node in the diversification of photosynthetic machinery across the green lineage. Comparative analysis reveals:

These comparative patterns highlight how core photosynthetic machinery has been largely conserved through evolution while peripheral elements have adapted to different ecological contexts.

What insights does the study of C. atmophyticus PsbA provide about the evolution of photosynthesis during the transition from aquatic to terrestrial environments?

The study of C. atmophyticus PsbA offers several key insights into photosynthetic evolution during the water-to-land transition:

  • Evolutionary positioning:
    As an early-diverging charophytic alga, C. atmophyticus occupies a pivotal position in the streptophyte lineage that ultimately gave rise to land plants. Its PsbA protein represents an ancestral state that predates the numerous adaptations required for terrestrial photosynthesis .

  • Photosystem adaptations:

    • The C. atmophyticus PsbA retains core functional elements found across photosynthetic organisms

    • Analysis of its structure can help identify specific adaptations that evolved later in land plants to cope with high light intensity, desiccation, and temperature fluctuations in terrestrial environments

    • The protein likely represents an intermediate state in the evolution of photoprotection mechanisms

  • Regulatory evolution:

    • The distinctive pattern of promoter conservation in C. atmophyticus—where some photosynthesis genes lack the conserved promoters found in other streptophytes—suggests that transcriptional regulation of photosynthesis genes underwent significant evolution during the colonization of land

    • This regulatory evolution may have been critical for coping with the more extreme light conditions experienced in terrestrial environments

  • Contextual cell biology:

    • Beyond the photosystem itself, C. atmophyticus shows interesting transitional features in cell wall composition, containing "pseudo-pectin" with distinctive properties compared to land plant cell walls

    • These parallel adaptations in both photosynthetic machinery and structural components illustrate the multifaceted nature of the evolutionary transition to land

Studying this evolutionary intermediate provides a unique window into the stepwise process of adaptation that ultimately enabled plants to colonize terrestrial environments and fundamentally transform Earth's ecosystems.

How can phylogenomic approaches incorporating PsbA sequences enhance our understanding of streptophyte evolution?

Phylogenomic approaches incorporating PsbA sequences provide powerful tools for resolving streptophyte evolutionary relationships and understanding photosynthetic adaptation:

  • Resolving deep phylogenetic relationships:

    • PsbA sequences, when analyzed alongside other conserved plastid genes, help resolve the branching order of early streptophyte lineages

    • High-throughput sequencing of chloroplast genomes, including psbA, has already challenged previous phylogenetic hypotheses for core Chlorophyta and early-diverging streptophytes

    • These analyses help clarify the evolutionary positioning of C. atmophyticus and other pivotal taxa in plant evolution

  • Detecting selection patterns:

    • Comparative analysis of PsbA sequences across diverse streptophytes can reveal sites under positive selection, indicating functional adaptation

    • Relaxed molecular clock analyses can identify lineages with accelerated evolutionary rates, potentially reflecting environmental adaptation

    • These patterns help identify key innovations in photosynthetic machinery during land plant evolution

  • Promoter evolution insights:

    • Analysis of psbA promoter regions across streptophytes has revealed interesting patterns of conservation and divergence

    • The exceptional conservation of bacterial-type promoters for genes including psbA in most streptophytes contrasts with their absence in some early-diverging taxa like C. atmophyticus for certain photosynthesis genes

    • This suggests complex evolutionary dynamics in transcriptional regulation systems

  • Methodological considerations:
    When using PsbA in phylogenomic analyses, researchers should:

    • Incorporate appropriate models of sequence evolution

    • Consider codon-based approaches for protein-coding regions

    • Implement partitioned analyses that account for different evolutionary rates across functional domains

    • Combine plastid data with nuclear and mitochondrial markers for robust phylogenomic inference

These phylogenomic approaches can help resolve remaining uncertainties in streptophyte relationships and provide insight into the genetic basis of adaptations that facilitated the colonization of land by plants.

What are the most promising methods for investigating PsbA function in C. atmophyticus and other early-diverging streptophytes?

Several methodological approaches show particular promise for investigating PsbA function in C. atmophyticus:

  • CRISPR-Cas9 genome editing:

    • Development of transformation protocols for C. atmophyticus would enable precise genetic manipulation

    • Site-directed mutagenesis of specific PsbA residues could help determine structure-function relationships

    • Creation of knockout and complementation lines would allow functional verification

  • Advanced biophysical techniques:

    • Ultrafast spectroscopy to measure electron transfer kinetics

    • EPR spectroscopy to analyze redox states of cofactors

    • Thermoluminescence and fluorescence measurements to assess energy transfer

    • Time-resolved crystallography to capture intermediate states during the catalytic cycle

  • Heterologous expression systems:

    • Expression of C. atmophyticus PsbA in model systems like Synechocystis

    • Complementation studies in cyanobacterial mutants lacking endogenous PsbA

    • Creation of chimeric proteins to identify domain-specific functions

  • Comparative physiology:

    • Measuring photosynthetic parameters across varying light, temperature, and CO2 conditions

    • Analyzing photoinhibition and recovery kinetics

    • Assessing ROS production and antioxidant response pathways

  • Multi-omics integration:

    • Correlation of transcriptomics, proteomics, and metabolomics data

    • Analysis of post-translational modifications affecting PsbA function

    • Investigation of protein-protein interactions within photosystem II complexes

These approaches could help resolve fundamental questions about photosynthetic evolution and adaptation during the critical transition from aquatic to terrestrial environments that C. atmophyticus represents as an early-diverging streptophyte.

What are the current challenges and knowledge gaps in understanding C. atmophyticus PsbA regulation and function?

Several significant challenges and knowledge gaps remain in our understanding of C. atmophyticus PsbA:

  • Transcriptional regulation:

    • The absence of conserved bacterial-type promoters for some photosynthesis genes in C. atmophyticus raises questions about alternative regulatory mechanisms

    • The relationship between promoter structure and environmental responsiveness remains poorly understood

    • The role of transcription factors in regulating psbA expression requires further investigation

  • Translational control:

    • Mechanisms controlling light-dependent translation of PsbA mRNA in C. atmophyticus have not been characterized

    • The potential role of RNA-binding proteins in regulating PsbA synthesis under different conditions is unknown

    • Whether translational regulation differs between C. atmophyticus and later-diverging streptophytes remains to be determined

  • Structural adaptations:

    • High-resolution structural data for C. atmophyticus PsbA is lacking

    • The relationship between sequence variations and functional differences compared to other organisms is poorly understood

    • The interaction between PsbA and other photosystem II components in C. atmophyticus has not been characterized in detail

  • Methodological limitations:

    • Lack of established transformation systems for C. atmophyticus

    • Challenges in culturing and maintaining consistent growth conditions

    • Difficulties in isolating intact photosystem complexes for functional studies

  • Evolutionary context:

    • Limited sampling of early-diverging streptophytes for comparative genomic analyses

    • Incomplete understanding of the selection pressures that shaped photosynthetic machinery in ancestral streptophytes

    • Gaps in our knowledge of the ecological and environmental context of C. atmophyticus evolution

Addressing these challenges will require interdisciplinary approaches combining molecular biology, biochemistry, structural biology, and evolutionary genomics to fully understand the role of PsbA in this evolutionarily significant organism.

How can structural studies of PsbA inform the design of artificial photosynthetic systems?

Structural studies of PsbA from organisms like C. atmophyticus can provide valuable insights for designing artificial photosynthetic systems:

  • Optimizing electron transfer pathways:

    • Detailed understanding of the electron transfer chain within PsbA can inform the spatial arrangement of redox-active components in artificial systems

    • Analysis of cofactor binding sites can guide the selection and positioning of chlorophylls, pheophytins, and quinones in synthetic constructs

    • Insights into the water oxidation mechanism at the manganese cluster can inspire improved water-splitting catalysts

  • Enhancing stability and turnover:

    • Identification of structural elements that confer resistance to photodamage

    • Understanding the D1 repair cycle to design self-healing artificial systems

    • Engineering interfaces that optimize energy transfer while minimizing harmful side reactions

  • Environmental adaptation lessons:

    • Comparing PsbA structures across diverse organisms from different environments can reveal adaptations to various light conditions, temperatures, and redox environments

    • As an early-diverging streptophyte, C. atmophyticus may reveal ancestral features that were optimized through evolution

    • These natural variations can guide rational design of artificial systems for specific environmental applications

  • Biomimetic approaches:

    • The modular nature of photosynthetic complexes suggests strategies for designing artificial systems with replaceable components

    • Understanding protein-protein and protein-lipid interactions can inform the development of self-assembling synthetic systems

    • PsbA's remarkable quantum efficiency (~95% under optimal conditions) provides a benchmark for artificial photosynthetic systems

  • Specific design principles:

    • Precise cofactor positioning to optimize electronic coupling

    • Strategic placement of charged amino acids to tune redox potentials

    • Control of proton-coupled electron transfer through hydrogen bonding networks

    • Management of energy and electron transfer rates to minimize wasteful charge recombination

These insights from natural photosynthetic systems can accelerate the development of artificial photosynthetic technologies for sustainable energy production, carbon fixation, and chemical synthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.