Recombinant Chlorokybus atmophyticus Probable sulfate transport system permease protein cysT (cysT)

Shipped with Ice Packs
In Stock

Description

Biological Role in Sulfate Transport

CysT functions as part of an ATP-binding cassette (ABC) transporter complex critical for sulfate uptake :

  • Structural Context: Partners with CysW (transmembrane protein) and CysA (ATPase subunit) to form a permease channel .

  • Operon Organization: In cyanobacteria and proteobacteria, cysT is typically co-expressed with cysW, cysA, and sbpA (sulfate-binding protein) .

  • Transport Mechanism:

    • Sulfate binds to periplasmic SbpA, which transfers it to the CysT/W transmembrane dimer.

    • ATP hydrolysis by CysA energizes sulfate translocation across the membrane .

Key Residues for Function :

  • D130: Conserved aspartic acid at TMH1 critical for sulfate binding.

  • R177: Arginine residue essential for transport activity (mutations reduce efficiency by 80%).

Evolutionary and Taxonomic Significance

CysT homologs exhibit conserved roles across diverse taxa:

  • Green Algae: Chloroplast-envelope ABC transporters in Scenedesmus acutus mirror cyanobacterial systems, with SulP/SulP2 analogs of CysT/CysW .

  • Proteobacteria: Escherichia coli CysT mutants require thiosulfate or cysteine supplementation, confirming its necessity in sulfate assimilation .

Research Applications

This recombinant protein is utilized for:

  • Functional Studies: Characterizing sulfate transport kinetics and inhibitor responses .

  • Comparative Genomics: Analyzing evolutionary divergence of ABC transporters in algae vs. bacteria .

  • Structural Biology: Crystallization trials to resolve transmembrane domain architecture .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cysT; Probable sulfate transport system permease protein cysT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Chlorokybus atmophyticus (Soil alga)
Target Names
cysT
Target Protein Sequence
MSTNEMNQKKRLNRSGSLSSHLTRSWPWQLTLSYLFFMLILPVIALLSRASDELFKDFWQ IAAEPVAISTYVVTLMTALFATLINGFFGVIIAWVLVRYNFPGKRIIDAAIDLPFALPTS VAGLTLATVYSDQGWIGHLFESIGIKVAFTRVGVAVAMIFVSFPFVVRTLQPVLVEIDQE LEEAAWSLGASTWRTFWRVIFPPLTPAIVTGVALAFSRAIGEYGSVVIVASNIPFKDLTA PVLIFQRLEQYDYTGATIIGTVILSISLFLLFGINFIQSLNQLYVK
Uniprot No.

Target Background

Function
This protein is part of the ABC transporter complex cysAWTP (TC 3.A.1.6.1) involved in sulfate/thiosulfate import. It is likely responsible for the translocation of the substrate across the membrane.
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is Chlorokybus atmophyticus and why is it significant for evolutionary studies?

Chlorokybus atmophyticus is a soil alga belonging to the streptophyte green algae lineage. It holds significant evolutionary importance as it represents one of the early-diverging lineages in streptophyte evolution. Comparative chloroplast genome analyses have positioned Chlorokybus within phylogenetic frameworks that help understand the evolution of land plants, with the Zygnematophyceae being identified as sister to land plants . Studying proteins like cysT from this organism provides insights into the evolution of sulfate transport mechanisms across the plant kingdom and helps establish the molecular basis for adaptations to terrestrial environments.

What is the basic function of the cysT protein in Chlorokybus atmophyticus?

The cysT protein in Chlorokybus atmophyticus functions as a sulfate transport system permease protein, forming part of the cell's sulfate uptake machinery. Based on its classification and homology to other sulfate transporters, it likely plays a crucial role in facilitating the movement of sulfate ions across cellular membranes . This function is essential for sulfur metabolism, which is vital for the synthesis of sulfur-containing amino acids, various cellular components, and defense compounds that help the organism cope with environmental stresses .

What are the optimal conditions for reconstitution and storage of recombinant cysT protein?

The recombinant cysT protein should be reconstituted in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the default concentration) and store aliquots at -20°C or -80°C .

To maintain protein integrity:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Avoid repeated freeze-thaw cycles, which can compromise protein structure

  • For working aliquots, store at 4°C for up to one week

  • The protein is supplied as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0

How can researchers verify the functionality of recombinant cysT protein in experimental systems?

Researchers can verify cysT functionality through multiple approaches:

  • Transport assays: Measuring the uptake of radiolabeled sulfate (35S-labeled sulfate) in systems expressing the recombinant protein compared to controls.

  • Complementation studies: Expressing the cysT protein in sulfate transport-deficient mutants (e.g., in E. coli or yeast systems) to assess functional restoration of sulfate uptake.

  • Electrophysiological measurements: Using patch-clamp techniques to measure membrane currents associated with sulfate transport in systems expressing cysT.

  • Binding assays: Analyzing the binding affinity of the protein for sulfate and potential competitive inhibitors such as chromate, which is known to compete with sulfate for uptake .

  • Protein interaction studies: Identifying partner proteins that may form functional complexes with cysT using techniques such as co-immunoprecipitation or yeast two-hybrid assays.

What expression systems are recommended for studying cysT protein function?

While the recombinant protein described in the search results was expressed in E. coli , researchers might consider several expression systems depending on their research goals:

The choice of expression system should be guided by the specific research question, whether focused on protein structure, interaction partners, or transport kinetics.

How does cysT expression respond to sulfur availability and environmental stressors?

While specific data for cysT in Chlorokybus atmophyticus is limited, research on similar sulfate transporters in algae provides insight into likely regulatory patterns:

Sulfate transporters typically show differential expression in response to:

  • Sulfur availability: In the green alga Scenedesmus acutus, sulfate transporters are significantly upregulated during sulfur starvation . We can hypothesize that cysT in Chlorokybus may similarly be induced under sulfur-limiting conditions to maximize sulfate uptake efficiency.

  • Heavy metal stress: Chromium exposure alters sulfate transporter expression in a strain-dependent manner in algae. This is particularly relevant as chromate can compete with sulfate for uptake, inducing a functional sulfur starvation .

  • Oxidative stress: Since sulfur is essential for the synthesis of antioxidant compounds, oxidative stress conditions may indirectly upregulate sulfate transport systems.

Gene expression analysis under various conditions would be necessary to confirm these regulatory patterns specifically for cysT in Chlorokybus atmophyticus.

What role might cysT play in the evolutionary adaptation of Chlorokybus atmophyticus to its soil habitat?

As a soil alga, Chlorokybus atmophyticus must adapt to variable sulfur availability and potential exposure to heavy metals and other environmental stressors. The cysT protein likely plays a crucial role in these adaptations:

  • Efficient sulfate acquisition: The presence of a dedicated sulfate permease system suggests evolutionary adaptation to environments where sulfate may be limited or variable.

  • Heavy metal tolerance: Based on studies in other algae, the sulfate transport system may contribute to heavy metal tolerance by:

    • Competing with toxic ions like chromate that use the same transport pathway

    • Supporting increased production of sulfur-containing defense compounds such as glutathione and phytochelatins

  • Stress response capacity: The ability to rapidly upregulate sulfate uptake in response to stress conditions would provide an adaptive advantage in fluctuating environments.

Comparative genomic and functional studies between Chlorokybus and other streptophyte algae from different habitats could provide insights into how the cysT protein may have evolved to support adaptation to terrestrial environments.

How does the structure and function of cysT in Chlorokybus atmophyticus compare to sulfate transporters in other streptophyte lineages?

Examining cysT within the evolutionary context of streptophyte algae reveals interesting patterns:

LineageSulfate Transport System FeaturesEvolutionary Significance
Chlorokybus (early-diverging streptophyte)Probable permease-type sulfate transporter (cysT) Represents ancestral condition in streptophytes
KlebsormidiophyceaeSimilar permease-type transporters with adaptations for terrestrial conditionsShows early adaptations toward land plant lineage
ZygnematophyceaeMost closely related to land plants ; likely shows transitional featuresProvides insights into pre-adaptation for land colonization
Land plantsEvolved specialized SULTR transporters with tissue-specific expressionAdapted for complex multicellular growth and specialization

Comparative structural analysis suggests that the transmembrane domains of cysT and related transporters are likely conserved across these lineages, while regulatory domains may show greater divergence reflecting adaptation to different environmental conditions. Further research comparing the kinetic properties and regulation of these transporters across streptophyte lineages would be valuable for understanding the evolution of sulfur metabolism in the green plant lineage.

What approaches can be used to study the localization and trafficking of cysT protein in cells?

To investigate the cellular localization and trafficking of the cysT protein, researchers can employ several complementary approaches:

  • Fluorescent protein tagging: Generation of cysT-GFP fusion constructs for expression and visualization in live cells using confocal microscopy.

  • Immunolocalization: Development of specific antibodies against cysT for immunofluorescence microscopy studies in fixed cells.

  • Subcellular fractionation: Biochemical separation of cellular compartments followed by Western blot analysis to detect the presence of cysT in different fractions.

  • Membrane topology mapping: Using techniques such as cysteine-scanning mutagenesis or protease protection assays to determine the orientation of the protein within the membrane.

  • Electron microscopy: Immunogold labeling for high-resolution localization studies, particularly useful for examining membrane-embedded proteins.

For studying trafficking dynamics, researchers might employ techniques like fluorescence recovery after photobleaching (FRAP) or photoactivatable GFP fusions to track protein movement between cellular compartments in real time.

How can researchers investigate potential interactions between cysT and other components of the sulfate transport system?

Investigating protein-protein interactions involving cysT requires a multi-faceted approach:

  • Co-immunoprecipitation (Co-IP): Using antibodies against cysT to pull down potential interaction partners, followed by mass spectrometry identification.

  • Yeast two-hybrid screening: Systematic screening for proteins that interact with cysT, though this may be challenging for membrane proteins.

  • Split-ubiquitin membrane yeast two-hybrid: A specialized variant designed for membrane protein interactions.

  • Bimolecular Fluorescence Complementation (BiFC): Expressing fragments of fluorescent proteins fused to potential interaction partners to visualize interactions in live cells.

  • Proximity labeling approaches: Techniques such as BioID or APEX2, where cysT is fused to an enzyme that biotinylates nearby proteins, allowing identification of the proximal proteome.

  • Crosslinking mass spectrometry: Chemical crosslinking of interacting proteins followed by mass spectrometry to identify interaction interfaces.

Based on studies of sulfate transport systems in other organisms, researchers should consider investigating interactions with ATP-binding cassette (ABC) transporter components, as sulfate permeases often function as part of larger complexes .

What experimental design would best assess the impact of environmental stressors on cysT function?

A comprehensive experimental design to assess environmental stressor impacts on cysT function should include:

  • Gene expression analysis:

    • qRT-PCR to measure cysT transcript levels under various stress conditions (sulfur limitation, heavy metal exposure, oxidative stress)

    • RNA-seq to place cysT regulation in the context of global transcriptional responses

  • Protein level analysis:

    • Western blotting to quantify cysT protein levels under stress conditions

    • Pulse-chase experiments to determine protein turnover rates

  • Functional transport assays:

    • Measurement of 35S-sulfate uptake kinetics under different stress conditions

    • Competition assays with chromate and other potential inhibitors

  • Mutagenesis studies:

    • Site-directed mutagenesis of key residues to identify domains important for stress response

    • Generation of cysT knockout/knockdown lines to assess phenotypic consequences

  • Physiological measurements:

    • Analysis of intracellular sulfur-containing metabolites (glutathione, cysteine) in response to stressors

    • Assessment of stress tolerance phenotypes in cells with altered cysT expression

A factorial experimental design varying both stress type and intensity would be ideal, with careful attention to time-course sampling to capture both immediate and adaptive responses.

How might CRISPR-Cas9 genome editing be applied to study cysT function in Chlorokybus atmophyticus?

CRISPR-Cas9 genome editing offers powerful approaches to investigate cysT function:

  • Gene knockout studies: Complete deletion of cysT to assess its essentiality and the phenotypic consequences of its absence. Alternative sulfate uptake pathways might be revealed through compensatory responses.

  • Domain-specific mutations: Introduction of specific mutations to disrupt functional domains while maintaining protein expression, allowing dissection of structure-function relationships.

  • Promoter modifications: Altering the native promoter to modulate expression levels or response to environmental cues.

  • Tagging at endogenous locus: Introduction of fluorescent or affinity tags at the endogenous locus to study the protein under native regulation.

  • Base editing applications: Precise modification of specific amino acids to assess their importance in transport function, substrate specificity, or regulation.

Challenges specific to Chlorokybus atmophyticus would include developing efficient transformation protocols and optimizing CRISPR-Cas9 components for this organism. Researchers might initially need to establish these techniques in more tractable green algal models before transferring them to Chlorokybus.

What insights might comparative studies of cysT across diverse algal lineages provide for understanding sulfate transport evolution?

Comparative studies of cysT and related transporters across diverse algal lineages could reveal:

  • Evolutionary trajectories: Mapping the diversification of sulfate transporter families from early-diverging algae to land plants to understand functional specialization.

  • Adaptation signatures: Identification of amino acid residues under positive selection that may reflect adaptation to different sulfate availabilities or environmental conditions.

  • Regulatory evolution: Comparison of promoter regions and expression patterns to understand how regulation has evolved across lineages.

  • Functional divergence: Experimental characterization of transporters from key lineages to determine changes in substrate specificity, transport kinetics, and regulatory responses.

  • Horizontal gene transfer assessment: Investigation of potential horizontal gene transfer events that might have contributed to sulfate transporter evolution.

Such comparative studies would be particularly valuable for understanding how the transition to land influenced the evolution of nutrient acquisition systems, using sulfate transport as a model.

How could systems biology approaches integrate cysT function into broader sulfur metabolism networks?

Systems biology approaches offer powerful tools to contextualize cysT function within broader metabolic networks:

  • Metabolic modeling: Development of genome-scale metabolic models incorporating sulfate transport and assimilation pathways to predict flux distributions under different conditions.

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data to map the response of the entire sulfur utilization network to environmental perturbations.

  • Protein-protein interaction networks: Mapping the interactome of sulfate transport and assimilation components to identify regulatory hubs and functional modules.

  • Comparative network analysis: Examining how sulfur metabolism networks differ across species with different ecological niches to identify conserved core functions versus adaptable peripheral components.

  • Synthetic biology applications: Redesigning sulfate transport systems based on systems-level understanding to enhance specific functions, such as heavy metal tolerance or growth in sulfur-limited environments.

This integrated approach would place cysT within its functional context and potentially reveal emergent properties not apparent from reductionist studies of individual components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.