Recombinant Chlorophyll a-b binding protein of LHCII type 1

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chlorophyll a-b Binding Protein of LHCII Type 1

Light-harvesting chlorophyll a/b-binding (LHCB) proteins are apoproteins that form the light-harvesting complex of photosystem II (PSII) . LHCB proteins are usually associated with chlorophyll and xanthophylls and act as the antenna complex . These complexes absorb sunlight and transfer excitation energy to the core complexes of PSII, which drives photosynthetic electron transport .

Function and Components

LHCII, the major light-harvesting complex, includes minor antenna complexes like LHCB4 (CP29), LHCB5 (CP26), and LHCB6 (CP24), along with major antenna complexes composed of homo- and heterotrimers of LHCB1, LHCB2, and LHCB3 . These proteins, found in the chloroplast/thylakoid, are encoded by nuclear genes . The light-harvesting complex (LHC) acts as a light receptor, capturing and delivering excitation energy to photosystems .

Recombinant Production and Isolation

To understand the functional aspects of LHCII, it is necessary to produce sufficient quantities of recombinant antenna proteins for biophysical experiments . Only organisms that synthesize both chlorophylls a and b, as well as carotenoids, can correctly fold antenna protein-pigment complexes because LHCII binds at least 12 chlorophylls, two carotenoid molecules, and two lipid species with different functions .

To separate native LHCII from recombinant LHCII, a polyhistidine peptide is introduced at the C terminus of the LHCII monomer, designated LHCII-His6 . This modification allows separation from native complexes . Recombinant monomeric proteins are obtained through detergent-mediated dissociation of pure LHCII trimers, and only recombinant monomers are retained on a nickel-chelating resin via affinity chromatography . These monomers can be reassembled into fully recombinant trimeric complexes and form two-dimensional (2D) crystals that diffract electrons to 3.6-Å resolution .

Impact of Chlorophyll b

Chlorophyll b plays a crucial role in the assembly and accumulation of light-harvesting complexes in vivo . It is hypothesized that the stronger coordination bonds between the magnesium atom in chlorophyll b and amino acid side chain ligands in chlorophyll a/b-binding apoproteins enhance their import into the chloroplast and assembly of light-harvesting complexes .

Experimental Results

A chimeric Lhcb gene encoding light-harvesting chlorophyll a/b-binding protein (LHCII) was expressed in transgenic tobacco plants . The recombinant LHCII was isolated using detergent-mediated monomerization of pure trimers, followed by affinity chromatography on Ni2+-NTA-agarose . Elution with imidazole yielded recombinant monomers that readily formed trimers after detergent dilution without further in vitro manipulations . The LHCII subunits displayed a typical chlorophyll a/b ratio throughout purification, indicating no significant pigment loss . The transgenic tobacco overexpressed recombinant protein, which corresponded to approximately 0.7% of total LHCII . After adding digalactolipids, recombinant LHCII formed two-dimensional crystals that diffracted electrons to 3.6-Å resolution .

Effects of Mutations

Mutations affecting phosphatidylglycerol binding at position 21 and chlorophyll a2 at position 183 significantly impact the amount of recombinant LHCII complexes . In both instances, protein accumulation decreased to 0.004% and 0.01%, respectively, compared to thylakoid proteins, indicating that LHCII biogenesis was impaired .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Chlorophyll a-b binding protein of LHCII type 1; Chlorophyll a-b binding protein of LHCII type I; CAB; LHCP; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Euglena gracilis
Target Protein Sequence
VVQALIHAKSLLAILATQVLLMGAVEGYRAGNTAPGQFGEDLDRLYPGGPFDPLGLADDP DTFPELKVKEIKNGRLAMSGMLGFYAQAIVTGEGPVENWLYHLQDPSAHNGLTALVTQFA PTPVALL
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What expression systems are suitable for producing recombinant Lhcb1 proteins?

Recombinant Lhcb1 proteins can be expressed in several systems, each with distinct advantages:

The choice depends on research goals:

  • For structural studies: E. coli expression followed by in vitro reconstitution is often used

  • For functional studies: Transgenic plant expression offers natively folded complexes

How can His-tagged recombinant Lhcb1 be separated from native LHCII in transgenic plants?

Separating recombinant from native LHCII requires a strategic approach:

  • Genetic modification: Extend the C-terminus of recombinant Lhcb1 with six histidines (His6-tag) .

  • Isolation procedure:

    • Isolate total LHCII trimers from transgenic plants

    • Monomerize the trimers using a detergent (typically dodecyl maltoside)

    • Perform affinity chromatography using Ni²⁺-NTA-agarose

    • Wash with buffer containing low imidazole concentration (e.g., 40 mM)

    • Elute recombinant His-tagged Lhcb1 with higher imidazole concentration

This approach is highly selective as native LHCII contains only three histidines that are not adjacent to each other and cannot bind effectively to Ni²⁺-NTA resin .

What factors affect the yield of recombinant Lhcb1 in transgenic plants?

Several factors influence the expression and accumulation of recombinant Lhcb1:

FactorImpact on YieldEvidence
Promoter choiceStrong constitutive promoters (e.g., 35S) increase transcriptionTransgenic plants using 35S promoter showed high expression of chimeric Lhcb gene
Transit peptideAffects chloroplast targeting efficiencyThe rbcS transit sequence from pea successfully directs LHCII into chloroplasts
Chlorophyll binding site mutationsDramatically reduces accumulationN183L mutation (affecting Chl a2 binding) reduced accumulation to 0.01% compared to wild-type
Phosphatidylglycerol binding site mutationsSeverely impairs biogenesisMutations at position 21 reduced accumulation to 0.004% of thylakoid proteins

In optimized systems, transgenic tobacco can express recombinant LHCII at approximately 0.7% of total LHCII .

What techniques are most effective for analyzing the structure of recombinant LHCII?

Several complementary techniques provide insights into LHCII structure:

How does the absence of specific chlorophyll binding sites affect recombinant Lhcb1 structure and function?

Mutation studies of chlorophyll binding sites reveal critical structure-function relationships:

  • N183L mutation (affecting Chl a2 binding site):

    • Dramatically reduces protein accumulation to 0.01% compared to wild-type

    • Indicates this chlorophyll is essential for proper protein folding and/or stability

    • Confirms the proposed atomic model of LHCII where Asn-183 serves as a key ligand for chlorophyll a

  • General observations:

    • Chlorophyll binding is not merely for light harvesting but plays structural roles

    • Proper occupancy of chlorophyll binding sites is essential for LHCII folding and stability

    • In chlorophyll b-deficient plants, LHCII does not accumulate to normal levels as stabilization of the folded protein by chlorophyll b is missing

This demonstrates that pigments serve dual functions in LHCII: light harvesting and structural stabilization.

What is the established protocol for in vitro reconstitution of recombinant Lhcb1?

The reconstitution process involves several critical steps:

  • Protein preparation:

    • Express the protein (typically in E. coli)

    • Isolate inclusion bodies containing the recombinant protein

    • Denature the protein using an ionic detergent (typically LDS)

  • Pigment preparation:

    • Extract chlorophylls a and b and carotenoids from plant material

    • Purify the pigments

    • Solubilize in a non-ionic detergent

  • Reconstitution reaction:

    • Mix the denatured protein with pigments

    • The protein spontaneously folds and associates with pigments

    • The process can be monitored by fluorescence spectroscopy

  • Verification of proper folding:

    • Compare absorption spectrum with native complex

    • Verify chlorophyll a/b ratio

    • Check oligomeric state (monomers vs. trimers)

This self-assembly feature of LHCII has made it a valuable model system for studying membrane protein folding and pigment-protein interactions .

What is the kinetics and sequence of events during recombinant Lhcb1 folding and pigment binding?

The folding process follows a defined temporal sequence:

Time PointEventTechnique for Detection
< 1 minuteInitial chlorophyll a bindingFluorescence spectroscopy
Several minutesChlorophyll b binding and stabilizationFluorescence spectroscopy
1 secondProtein remains largely unfoldedDEER with rapid freeze-quench
Tens of secondsCore structure formation, transmembrane helix positioningDEER distance measurements
MinutesFinal folding steps including superhelix formation of helices 1 and 4DEER distance measurements

Key findings from DEER experiments with site-specific spin labeling:

  • The positioning of spin pairs spanning the hydrophobic core of LHCII clearly precedes the juxtaposition of spin pairs on the luminal side

  • This indicates that superhelix formation of helices 1 and 4 is a late step in LHCII assembly

These kinetic studies demonstrate that LHCII folding is a cooperative process dependent on pigment binding, with distinct temporal phases.

How do Lhcb1 and Lhcb2 differ functionally in photosynthetic light harvesting?

Despite their high sequence similarity, Lhcb1 and Lhcb2 have distinct complementary functions:

  • Trimeric assembly:

    • Lhcb1 is essential for normal LHCII trimer formation; plants lacking Lhcb1 show profound antenna remodeling with decreased LHCII trimer amounts

    • Lhcb2 can form homotrimers but cannot fully compensate for Lhcb1 loss

    • Lhcb3 cannot form homotrimers and requires Lhcb1 for stable trimerization

  • State transitions:

    • Both proteins are necessary but neither is sufficient alone

    • Lhcb2 is phosphorylated more rapidly than Lhcb1

    • The state transition-specific PSI-LHCII complex contains only phospho-Lhcb2, not phospho-Lhcb1

    • Plants lacking only Lhcb2 contain thylakoid protein complexes similar to wild-type (with Lhcb1 replacing Lhcb2) but cannot perform state transitions

This functional specialization explains why plants maintain both proteins despite their structural similarity.

What role does chlorophyll b reductase play in the degradation of recombinant LHCII?

Chlorophyll b reductase is critical for initiating LHCII degradation:

  • Biochemical function:

    • Catalyzes the conversion of chlorophyll b to 7-hydroxymethyl chlorophyll a

    • This is the first step in chlorophyll b degradation

  • Genetic evidence:

    • In Arabidopsis mutants lacking chlorophyll b reductase genes (nyc1 and nol), chlorophyll b and LHCII are not degraded during senescence

    • Other pigment complexes completely disappear, indicating specific involvement in LHCII degradation

  • Mechanism of action:

    • When purified trimeric LHCII is incubated with recombinant chlorophyll b reductase (NOL), chlorophyll b is converted to 7-hydroxymethyl chlorophyll a

    • This conversion leads to release of chlorophylls from LHCII apoproteins

    • Interestingly, chlorophyll-depleted LHCII apoproteins remain in trimeric form rather than dissociating into monomers

This discovery suggests a novel degradation pathway where chlorophyll b reductase catalyzes the initial step of LHCII degradation by converting chlorophyll b, leading to pigment release and subsequent protein degradation.

How can site-directed mutagenesis of recombinant Lhcb1 advance our understanding of photosynthetic light harvesting?

Site-directed mutagenesis offers powerful insights into structure-function relationships:

  • Pigment binding site mutations:

    • N183L mutation (affecting Chl a2 binding) dramatically reduces protein accumulation to 0.01%

    • Confirms the proposed atomic model of LHCII and the importance of specific chlorophylls for protein stability

    • Can experimentally verify tentative assignments of chlorophyll a vs. b binding sites

  • Phosphatidylglycerol binding site mutations:

    • Mutations at position 21 reduce protein accumulation to 0.004%

    • Demonstrates the crucial role of specific lipid binding for LHCII biogenesis

  • Phosphorylation site mutations:

    • Mutations in N-terminal Thr residues alter state transition dynamics

    • Help elucidate the role of specific phosphorylation sites in protein-protein interactions during state transitions

These studies collectively demonstrate that mutagenesis of recombinant Lhcb1 can provide insights into pigment binding, lipid interactions, and regulatory phosphorylation that would be difficult to obtain by other means.

What novel applications of recombinant LHCII have emerged beyond photosynthesis research?

Recombinant LHCII proteins have found unexpected applications:

  • Cytokine neutralization:

    • Chlorophyll a-b binding protein AB96 from Vernonia amygdalina was discovered to bind to and functionally inhibit active TGFβ1

    • This represents the first plant-derived cytokine-neutralizing protein to be described

    • May explain some of the medicinal benefits associated with consumption of this plant species for treating parasitic infections

  • Model system for membrane protein folding:

    • The spontaneous self-assembly properties of LHCII make it an excellent model for studying membrane protein folding mechanisms

    • Has been used with biophysical techniques like DEER to understand folding kinetics and pathways

  • Biotechnology applications:

    • Expression in transgenic plants with His-tags demonstrates the potential for producing modified photosynthetic proteins for biotechnological applications

    • The demonstrated yield of 0.7% of total LHCII suggests plant-based expression could be a viable alternative to other eukaryotic expression systems

These diverse applications highlight how fundamental research on recombinant LHCII has expanded into unexpected domains beyond basic photosynthesis research.

How can researchers reconcile conflicting data about recombinant LHCII assembly and stability?

When faced with contradictory results, consider these methodological differences:

When comparing studies, carefully evaluate these factors to determine whether discrepancies reflect methodological differences rather than contradictory biology.

What are the most common technical challenges in working with recombinant LHCII and how can they be overcome?

ChallengeSolutionRationale
Low expression yieldUse strong promoters (35S for plants); optimize codon usage for E. coliIncreases transcription and translation efficiency
Distinguishing recombinant from native proteinAdd His6-tag to C-terminusEnables selective purification by Ni²⁺-NTA chromatography
Protein instability during purificationMaintain chlorophyll a/b ratio throughoutLoss of pigments destabilizes protein complexes
Heterogeneity in reconstituted complexesUse defined pigment mixtures with precise chlorophyll a:b ratiosControls for variability in binding specificity
Difficulty verifying proper foldingCompare absorption spectra with native complexesSpectral properties are sensitive indicators of correct pigment-protein interactions
Aggregation during reconstitutionCarefully control detergent concentrationsToo little detergent causes aggregation; too much prevents trimerization

Success with recombinant LHCII requires careful attention to these technical details, particularly maintaining the native-like environment during all experimental manipulations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.