Recombinant Chlorophyll a/b light-harvesting protein pcbC (pcbC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us and we will prioritize development of the specified tag.
Synonyms
pcbC; Chlorophyll a/b light-harvesting protein PcbC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-375
Protein Length
full length protein
Species
Prochlorothrix hollandica
Target Names
pcbC
Target Protein Sequence
MEECSCDNRFRRGNNEPAGFSLDEQWWAGNIRLVDLSGQLLGAHIAHAGLIAFWAGSITV LEVARYVPDVPFYEQGLGLLPHLATLGFGIGPDGTVVDTYPYFVIGILHLVTSAVLGAGG LFHTFKGPAILAEGGALAPKFHYDWGDTKQLSLILGHHLLLLGILCLAFVAKAMFWGGVY DASLGTVHTVSPNLNPADIFGYVFGFNHGQFNGLGMSSVDNLPDIIGGHVYIGILELIGG TWHILTKPFAIGAKPFSFSGEAILSYSLGAVGWMGLLSGFFVRYCDAAYPPQFYGPERSG AAAVQYILGVLLLVGHVWHATRARAGGEPVPYTPPAPQRGRFGMTRVAPAPARTFIGRGK PQPEPPKKKGLFGRG
Uniprot No.

Target Background

Function
The antenna complex functions as a light receptor, capturing and delivering excitation energy to photosystems II and I. The Prochlorales pcb genes are not related to higher plant LHCs.
Protein Families
PsbB/PsbC family, IsiA/Pcb subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is pcbC and what is its functional role in photosynthetic organisms?

pcbC is a gene encoding a chlorophyll a/b-binding protein that functions as a light-harvesting antenna primarily associated with Photosystem I (PSI) in certain cyanobacteria, particularly in the genus Prochlorococcus. The PcbC protein plays a crucial role in light energy capture and transfer to photosynthetic reaction centers. Unlike many other antenna proteins, PcbC is specifically induced under iron depletion conditions in some strains, suggesting it has evolved as an adaptation to iron-limited environments in the ocean . The protein belongs to the family of chlorophyll-binding proteins that increase the absorption cross-section of photosystems, enabling the organism to efficiently capture light energy across different wavelengths.

How does pcbC differ structurally and functionally from other light-harvesting proteins?

PcbC differs from other light-harvesting proteins in several key aspects:

  • Iron regulation: Unlike constitutively expressed light-harvesting proteins, pcbC is specifically induced under iron stress conditions in certain Prochlorococcus strains like MIT9313 .

  • Photosystem association: PcbC is specifically associated with Photosystem I (PSI), while other Pcb proteins may associate with Photosystem II (PSII) .

  • Evolutionary origin: PcbC is evolutionarily related to IsiA (iron-stress-induced protein A) found in other cyanobacteria, suggesting adaptation of this protein family for specialized functions .

  • Pigment binding: While most light-harvesting proteins in plants and algae bind both chlorophyll a and b in specific ratios, PcbC may have different pigment-binding properties adapted to the oceanic light environment.

  • Structure: Unlike the trimeric LHCII complexes of plants, PcbC forms rings around PSI, similar to how IsiA forms rings around PSI in other cyanobacteria under iron stress.

What organisms naturally express pcbC proteins, and how is this distribution ecologically significant?

pcbC proteins are primarily found in:

  • Prochlorococcus strains: Particularly in low-light adapted ecotypes like Prochlorococcus sp. strain SS120 . These marine cyanobacteria are among the most abundant photosynthetic organisms in the ocean.

  • Low-light adapted marine environments: The distribution of pcbC varies among Prochlorococcus ecotypes in an ecologically significant pattern - low-light adapted strains such as SS120 express pcbC under iron-replete conditions, while some strains like MIT9313 express pcbC only during iron stress . High-light adapted strains may lack pcbC altogether or have modified versions.

This distribution correlates with depth zonation in the ocean, with PcbC playing a more significant role in deeper water adaptation where light intensity is lower but blue-green wavelengths predominate.

What are the most effective methods for isolating and purifying recombinant pcbC proteins?

Isolating and purifying recombinant pcbC proteins presents several challenges due to their hydrophobic nature and pigment-binding properties. Based on strategies used for similar proteins, the following methodological approach is recommended:

  • Heterologous expression system selection:

    • E. coli is commonly used but produces inclusion bodies requiring refolding

    • For functional studies, expression in cyanobacterial hosts may be preferable

  • Affinity tag strategy:

    • N-terminal or C-terminal His₆-tag facilitates purification

    • GST or MBP fusion tags can improve solubility

  • Solubilization and purification protocol:

    • Solubilize inclusion bodies using 8M urea or 6M guanidine hydrochloride

    • For refolding, use a stepwise dialysis approach with appropriate detergents:

      • Start with 1% n-dodecyl-β-D-maltoside (DDM)

      • Gradually reduce to 0.03% DDM in final buffer

    • Purify using immobilized metal affinity chromatography (IMAC)

    • Further purify by size exclusion chromatography

This approach has been successful for similar proteins like CP24, which was reconstituted following bacterial expression of the apoprotein .

What reconstitution protocols yield functional pcbC complexes with chlorophylls and carotenoids?

Reconstitution of pcbC with chlorophylls and carotenoids is essential for functional studies. Based on successful protocols for similar proteins, the following methodology is recommended:

  • Pigment preparation:

    • Extract chlorophylls a and b from spinach or other plant material using acetone extraction

    • Purify pigments using HPLC with a C18 reverse-phase column

    • Dissolve purified pigments in organic solvent (acetone or dimethylformamide)

  • Step-by-step reconstitution protocol:

    • Solubilize purified pcbC apoprotein (1 mg) in denaturation buffer (8M urea, 10 mM Tris-HCl pH 8.0)

    • Add pigment mixture with chlorophyll a:b ratio of 3:1 (total 10-fold molar excess)

    • Add lipids (phosphatidylglycerol and digalactosyldiacylglycerol, 1:4 ratio)

    • Remove urea by 4-step dialysis against decreasing urea concentrations

    • Final dialysis against reconstitution buffer (10 mM HEPES pH 7.5, 100 mM NaCl, 0.03% DDM)

    • Remove unbound pigments using sucrose gradient ultracentrifugation

  • Optimizing chlorophyll a:b ratios:

    • Different ratios can be used to create proteins with varied spectroscopic properties

    • For pcbC, recommended to try ratios from 1:1 to 10:1 (Chl a:b)

    • Total pigment:protein ratio should be maintained at 10:1 molar ratio

This approach is modeled after successful reconstitution protocols for CP24 and related light-harvesting proteins .

How can site-directed mutagenesis be applied to investigate pigment binding sites in pcbC?

Site-directed mutagenesis provides a powerful approach to investigate specific pigment binding sites within pcbC:

This approach allows systematic identification of residues controlling pigment binding specificity and energy transfer properties in pcbC.

How does iron availability affect pcbC expression and function?

Iron availability is a critical factor regulating pcbC expression and function, particularly in marine cyanobacteria like Prochlorococcus:

  • Expression regulation under iron limitation:

    • In Prochlorococcus sp. strain MIT9313, pcbC is specifically induced during iron stress

    • In contrast, in strain SS120, pcbC is expressed under iron-replete conditions while another protein (PcbG) is repressed under iron stress

    • Transcriptional regulation likely involves iron-responsive transcription factors

  • Functional adaptation to iron limitation:

    • Under iron limitation, PcbC forms an extended antenna around PSI, increasing its absorption cross-section

    • This adaptation compensates for reduced PSI:PSII ratios typically observed under iron limitation

  • Iron concentration thresholds for pcbC induction:

    Iron Concentration (nM)pcbC Expression in MIT9313pcbC Expression in SS120
    >10 (iron-replete)Low/undetectableHigh
    1-10 (moderate limitation)ModerateModerate
    <1 (severe limitation)HighLow

Understanding the iron-responsive regulation of pcbC provides insights into how marine cyanobacteria adapt to the iron-limited regions of the ocean .

What spectroscopic methods are most appropriate for characterizing pcbC-pigment interactions?

Characterizing pcbC-pigment interactions requires a combination of spectroscopic techniques:

  • Absorption spectroscopy (400-700 nm):

    • Provides information on pigment composition and relative amounts

    • Characteristic peaks for chlorophyll a (430-440 nm, 660-670 nm)

    • Characteristic peaks for chlorophyll b (455-465 nm, 645-655 nm)

  • Gaussian deconvolution of absorption spectra:

    • Decompose complex spectra into individual pigment contributions

    • For chlorophyll b in protein environments, expected subbands at approximately 638, 645, 653, and 659 nm

    • For chlorophyll a in protein environments, expected subbands at approximately 666, 673, 679, and 686 nm

  • Fluorescence spectroscopy:

    • Steady-state emission spectra (excitation at 440 nm for Chl a, 475 nm for Chl b)

    • Excitation spectra (monitoring emission at 680 nm)

    • Time-resolved fluorescence for energy transfer kinetics

  • Circular dichroism (CD) spectroscopy:

    • Provides information on pigment-pigment interactions and protein secondary structure

    • Characteristic CD signals for excitonically coupled chlorophylls

  • Resonance Raman spectroscopy:

    • Identifies specific pigment-protein interactions

    • Detects changes in carotenoid configuration and chlorophyll coordination

These spectroscopic approaches have been successfully applied to similar proteins like CP24 and can be adapted for pcbC characterization.

How can pigment binding specificity and stoichiometry of pcbC be quantitatively determined?

Determining the pigment binding specificity of pcbC requires a systematic approach combining biochemical and spectroscopic methods:

  • In vitro reconstitution with defined pigment mixtures:

    • Reconstitute apoprotein with different ratios of chlorophyll a and b

    • Test binding of various carotenoids (lutein, violaxanthin, zeaxanthin)

    • Analyze bound pigments by HPLC after protein purification

  • Quantitative pigment extraction and analysis:

    • Extract pigments from purified protein complexes using 80% acetone

    • Separate and quantify pigments using HPLC with appropriate standards

    • Calculate molar ratios based on extinction coefficients

  • Pigment binding capacity analysis:

    PigmentExpected Binding CapacityDetection Method
    Chlorophyll a5-8 molecules per monomerAbsorption at 663 nm, HPLC
    Chlorophyll b2-5 molecules per monomerAbsorption at 645 nm, HPLC
    Carotenoids1-2 molecules per monomerAbsorption at 450-500 nm, HPLC
  • Competition assays:

    • Perform reconstitution with mixtures of pigments to determine preferential binding

    • Vary the ratio of competing pigments (e.g., Chl a vs. Chl b)

    • Determine the composition of bound pigments using HPLC analysis

This methodological approach will provide comprehensive information about the pigment binding specificity of pcbC, similar to studies performed with CP24 which was found to bind a total of 10 chlorophyll molecules and two xanthophyll molecules per monomer .

What is the evolutionary relationship between pcbC and other antenna proteins?

The evolutionary relationship between pcbC and other antenna proteins reveals important insights into the adaptation of photosynthetic organisms to different light environments:

  • Phylogenetic analysis of pcbC in relation to other antenna proteins:

    • pcbC belongs to the chlorophyll a/b-binding protein family that evolved from an ancestral IsiA-like gene

    • The ancestral gene likely underwent duplication early in Prochlorococcus evolution

    • Subsequent diversification led to specialized functions of different pcb genes

  • Evolutionary relationships among antenna protein families:

    Protein FamilyPrimary OrganismsEvolutionary Relationship to pcbC
    Pcb proteinsProchlorococcus, ProchloronClosest homologs, same protein family
    IsiAMost cyanobacteriaDirect ancestor of Pcb proteins
    CP43All oxygenic phototrophsDistant homolog, structural similarity
    LHC proteinsPlants, algaeConvergent evolution, different origin
  • Sequence conservation analysis:

    • Conserved histidine residues for chlorophyll binding

    • Transmembrane helices show highest conservation

    • Loop regions display greater variability

    • Key differences in residues that determine chlorophyll a vs. b specificity

This evolutionary perspective helps explain the diversity of pcb proteins in Prochlorococcus and their specialized roles in photosynthetic light harvesting under different environmental conditions .

How does pcbC contribute to photoadaptation in low-light environments?

pcbC plays a crucial role in photoadaptation to low-light environments, particularly in marine cyanobacteria like Prochlorococcus that dominate in the deep euphotic zone:

  • Functional role in low-light adaptation:

    • Increases the effective absorption cross-section of PSI

    • Optimizes light harvesting in blue-green light predominant at depth

    • Contributes to efficient excitation energy transfer to reaction centers

  • Expression patterns correlated with depth:

    Depth (m)Light Intensity (% surface)pcbC Expression LevelOther Adaptations
    0-25100-50%Low/absent in HL ecotypesHigh photoprotection capacity
    25-5050-25%Low/moderateIntermediate antenna size
    50-10025-10%Moderate/highIncreased pigment content
    >100<10%Highest in LL ecotypesMaximized antenna size
  • Experimental evidence for low-light adaptation role:

    • Low-light adapted Prochlorococcus strains like SS120 contain multiple pcb genes

    • pcbC forms an extended antenna around PSI in low-light conditions

    • Spectroscopic evidence shows enhanced energy transfer efficiency

    • Comparative genomics shows correlation between pcb gene number and depth distribution

Understanding pcbC's contribution to low-light adaptation provides insights into how Prochlorococcus has become the dominant phototroph in oligotrophic oceans and how it may respond to changing light conditions with climate change .

What structural features determine pcbC's specificity for chlorophyll a versus chlorophyll b?

The structural features that determine pcbC's ability to bind chlorophyll a versus chlorophyll b are critical for understanding its function:

  • Key amino acid residues determining chlorophyll specificity:

    • Specific histidine residues coordinate the central Mg²⁺ of chlorophylls

    • Polar residues form hydrogen bonds with chlorophyll substituents

    • Hydrophobic residues create the binding pocket environment

    • Key differences from non-Chl b binding proteins include specific polar residues accommodating the formyl group of Chl b

  • Detailed binding site comparison:

    Binding Site FeatureChlorophyll a BindingChlorophyll b BindingStructural Element
    Central coordinationHistidine (conserved)Histidine (conserved)Transmembrane helices
    Formyl group interactionAbsentPolar residue (Gln/Asn)Helix-loop interface
    Phytyl chain environmentHydrophobic pocketHydrophobic pocketHelix interfaces
    Peripheral interactionsVan der WaalsVan der Waals + H-bondsVarious
  • Experimental approaches to determine binding site specificity:

    • Site-directed mutagenesis of candidate residues

    • Reconstitution with modified chlorophylls

    • Resonance Raman spectroscopy to identify specific interactions

    • Hydrogen-deuterium exchange mass spectrometry

Understanding these structural determinants not only explains the natural function of pcbC but also provides the foundation for engineering artificial light-harvesting systems with tailored properties for biotechnological applications.

Do I need IBC approval for working with recombinant pcbC proteins?

Working with recombinant pcbC proteins typically requires Institutional Biosafety Committee (IBC) approval, though the specific requirements depend on the nature of your experiments:

  • General IBC requirements for recombinant DNA work:

    • Research involving recombinant or synthetic nucleic acids generally requires IBC review

    • This includes cloning, expression, and purification of recombinant pcbC

    • The level of review depends on risk assessment and containment needs

  • Determining if your work requires IBC approval:

    • Expression of pcbC in standard laboratory strains like E. coli K-12 is typically considered non-exempt work requiring registration

    • Use of viral vectors for pcbC expression would require IBC approval

    • Large-scale culture (>10 liters) would require additional considerations

  • Registration process overview:

    • Submit an IBC application describing the recombinant DNA work

    • Include details on gene source, expression systems, and experimental procedures

    • Identify appropriate biosafety level and containment measures

Always consult with your institutional biosafety officer for guidance specific to your institution's requirements and procedures .

What are the most common technical challenges in working with recombinant pcbC?

Researchers working with recombinant pcbC typically encounter several technical challenges that must be addressed for successful experiments:

  • Protein solubility and stability issues:

    • Challenge: pcbC is a membrane protein prone to aggregation

    • Solution: Optimize detergent selection; try DDM, LDAO, or digitonin

    • Approach: Screen multiple detergents at various concentrations

    • Assessment: Monitor by size exclusion chromatography and dynamic light scattering

  • Apoprotein refolding efficiency:

    • Challenge: Low yield of correctly folded protein during reconstitution

    • Solution: Optimize refolding conditions including urea gradient, pH, and temperature

    • Approach: Use stepwise dialysis with decreasing denaturant concentration

    • Assessment: Measure percent yield of pigment-binding competent protein

  • Pigment integration and stoichiometry:

    • Challenge: Achieving consistent and defined pigment composition

    • Solution: Control pigment ratios during reconstitution; purify pigments to high homogeneity

    • Approach: Perform reconstitutions with varying pigment ratios and analyze bound pigments

    • Assessment: Quantify bound pigments by HPLC analysis after extraction

  • Spectroscopic characterization limitations:

    • Challenge: Overlapping spectral features of different pigments

    • Solution: Use Gaussian deconvolution of absorption spectra and complementary techniques

    • Approach: Combine absorption, fluorescence, and CD spectroscopy with global analysis

    • Assessment: Compare with known spectra from established antenna proteins

Addressing these challenges requires systematic optimization and method development but is essential for obtaining reliable data on pcbC structure and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.