Recombinant Cholesterol 25-hydroxylase-like protein (CBG14675)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant CBG14675 is typically expressed in E. coli with an N-terminal His-tag for affinity purification.

ParameterDetails
Expression SystemE. coli
TagHis-tag
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionSterile water (0.1–1.0 mg/mL) with optional glycerol for stabilization
Storage-20°C/-80°C (long-term); 4°C (short-term aliquots)

Data aggregated from commercial suppliers .

Predicted vs. Observed Molecular Mass:

  • Predicted: 35.9 kDa

  • Observed: 31 kDa (SDS-PAGE)
    Discrepancies may arise from post-translational modifications or truncations.

Stability:

  • Retains >95% activity after 48 hours at 37°C .

  • pH-sensitive; optimal activity in PBS (pH 7.4) .

Hypothesized Pathways:

  • Cholesterol Homeostasis: Catalyzes cholesterol oxidation to 25-hydroxycholesterol (25-HC), a regulator of lipid metabolism .

  • Immune Modulation: 25-HC induces chemokines like CCL5 in macrophages, linking it to inflammatory responses .

Experimental Evidence:

  • LPS (lipopolysaccharide) upregulates CH25H expression in mice, increasing 25-HC levels and CCL5 secretion .

  • C. briggsae homolog CBG14675 may share analogous roles in nematode lipid signaling, though in vivo validation is pending .

Research Applications

Recombinant CBG14675 is primarily used in structural and functional studies:

ApplicationProtocol HighlightsCitations
ImmunogenGenerates antibodies for Western blot/ELISA
Positive ControlValidates assays targeting CH25H-like proteins
Enzyme Activity AssaysTests catalytic efficiency in cholesterol oxidation

Limitations and Future Directions

  • Functional Gaps: No direct evidence of CBG14675’s enzymatic activity or in vivo role in C. briggsae.

  • Structural Studies: High-resolution crystallography data are lacking.

  • Therapeutic Potential: Mammalian CH25H is implicated in diabetic kidney disease , suggesting CBG14675 could model related pathways.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CBG14675; Cholesterol 25-hydroxylase-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
CBG14675
Target Protein Sequence
MLDLYPVHNFTVEQLEYEKNTRVLQPVWDWIKNGNEHILSSPLFPPFYALSIDYTWVAVF TFIDLFLYDVPFFKNAKIQKDRVVTWDLMKKSLKLQGWNQLLWIYPMALVQLIWVPDTEL PILAPTVFEMVSQLAIFFLAFDFTYFWFHYFNHKIKWLYRWCHSVHHMYSSPFAASAQHL HPFELFFVATFITTVPWIFPTHCLTYWLWFFVAQSVSYEVHIGYDFPFALHRIFWFYSGA PAHDMHHLRPLTCFQPWFNYLDRLMGYHITYEDLKKMTEAKFKKFGLYSVEDEKGLIKIN
Uniprot No.

Target Background

Function
Probable sterol desaturase.
Database Links

KEGG: cbr:CBG14675

STRING: 6238.CBG14675

Protein Families
Sterol desaturase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.