Recombinant Cholesterol 25-hydroxylase-like protein (F35C8.5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
F35C8.5; Cholesterol 25-hydroxylase-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
F35C8.5
Target Protein Sequence
MLDLYPVQNLTVDQLEYEKNTRFLQPAWDWIKNGNEHILSSPLFPPFYALSIDYTWVAVF TFIDVFLCNVPFFKDAKIQKDRKVTWDLIKKSLKLQGWNQLLWIYPMALVQLIWVPDTEL PILAPTVFEMLSQLAIFFLAFDFTYFWFHYINHKVKWLYRWCHSVHHMYSSPFAASAQHL HPFELFFVGTFITTIPWIFPTHCLTYWIWFFIAQSVSYEVHIGYDFPFALHRIFWFYSGA PAHDMHHLRPLTCFQPWFNYLDRLMGYHITYADLKKMTEAKFKKFGLYSAEDEKGLIKIN
Uniprot No.

Target Background

Function
Probable sterol desaturase.
Database Links

KEGG: cel:CELE_F35C8.5

STRING: 6239.F35C8.5

UniGene: Cel.1071

Protein Families
Sterol desaturase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Cholesterol 25-hydroxylase-like protein (F35C8.5) and how does it relate to mammalian Ch25h?

Cholesterol 25-hydroxylase-like protein (F35C8.5) is a C. elegans ortholog of the mammalian Ch25h enzyme. Like its mammalian counterpart, it catalyzes the conversion of cholesterol to 25-hydroxycholesterol (25OHC). While the mammalian Ch25h is well-characterized as an immunoregulatory protein induced by IL-27 and type I interferons, the C. elegans F35C8.5 likely performs similar metabolic functions but within different signaling contexts due to the invertebrate's distinct immune system .

What is the evolutionary conservation pattern of Ch25h across species?

Cholesterol 25-hydroxylase shows moderate sequence conservation across species, with functional domains highly preserved despite variations in regulatory regions. The catalytic domain responsible for the hydroxylation of cholesterol at the 25-position remains particularly conserved. In C. elegans, F35C8.5 represents a functional homolog that maintains the core enzymatic activity while adapted to nematode-specific metabolic requirements. Phylogenetic analyses suggest Ch25h enzymes evolved early in metazoan development, emphasizing their fundamental role in cholesterol metabolism.

What are the known functional domains of recombinant F35C8.5 protein?

The recombinant F35C8.5 protein contains several key domains typical of Ch25h family members:

DomainPositionFunction
Catalytic domainN-terminalHydroxylation of cholesterol
Di-iron binding motifsCentral regionCoordinates metal ions essential for catalysis
Membrane-binding domainC-terminalAnchors protein to endoplasmic reticulum
Regulatory regionVariableModulates enzyme activity in response to cellular signals

How is F35C8.5 gene expression regulated in C. elegans?

Unlike mammalian Ch25h, which is strongly regulated by immune cytokines like IL-27 and type I interferons, F35C8.5 regulation in C. elegans likely relies on different signaling pathways appropriate to invertebrate physiology. Current research suggests that developmental stage-specific factors, metabolic status, and environmental stressors may all contribute to expression control. The absence of IL-27 and interferon pathways in C. elegans indicates alternative regulatory mechanisms evolved for this metabolic enzyme.

What expression systems are most effective for producing recombinant F35C8.5 protein?

For recombinant F35C8.5 production, several expression systems have been evaluated:

Expression SystemYieldSolubilityActivityNotes
E. coli BL21(DE3)ModeratePoorVariableRequires optimization of induction temperature (16-18°C)
E. coli Rosetta2Moderate-HighModerateGoodAddresses rare codon usage in C. elegans genes
Insect cells (Sf9)HighGoodExcellentCloser to native folding environment
Yeast (P. pastoris)ModerateGoodGoodSuitable for scaled production

What purification strategy yields the highest purity and activity for recombinant F35C8.5?

A multi-step purification approach is recommended:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) with His-tagged protein

  • Intermediate purification: Ion exchange chromatography (typically anion exchange at pH 8.0)

  • Polishing: Size exclusion chromatography

For membrane-associated forms of F35C8.5, detergent screening is critical with mild detergents like DDM or CHAPS showing the best results for maintaining enzymatic activity. Purification buffers should include reducing agents (1-5 mM DTT or β-mercaptoethanol) to protect critical cysteine residues involved in the catalytic mechanism. The final preparation should be analyzed by SDS-PAGE and western blotting to confirm identity and purity.

How can researchers overcome solubility challenges when expressing recombinant F35C8.5?

Solubility challenges with F35C8.5 can be addressed through several established strategies:

  • Expression as a fusion protein with solubility enhancers (MBP, SUMO, Trx)

  • Co-expression with molecular chaperones (GroEL/ES, DnaK/J)

  • Reduced induction temperature (16°C) and IPTG concentration (0.1-0.5 mM)

  • Inclusion of mild detergents or lipids during cell lysis and purification

  • Refolding from inclusion bodies using a gradual dialysis protocol with arginine as a solubility enhancer

Notably, truncation constructs removing the C-terminal membrane-binding domain have shown improved solubility while maintaining catalytic activity, making them useful for structural and functional studies.

What are the validated methods for measuring F35C8.5 enzymatic activity?

Several complementary methods have been developed for assessing F35C8.5 activity:

Assay TypeMeasurementSensitivityAdvantagesLimitations
GC-MSDirect quantification of 25OHCHighGold standard; highly specificRequires specialized equipment
LC-MS/MSDirect quantification of 25OHCVery highExcellent sensitivity; can measure multiple oxysterolsTechnical expertise required
Coupled enzyme assayNADPH consumptionModerateReal-time monitoring; simpler equipmentIndirect measurement
Radioisotope assayConversion of 3H-cholesterolHighEstablished method; good sensitivityHandling radioactive materials

When using these assays, researchers should incorporate appropriate controls including heat-inactivated enzyme, known Ch25h inhibitors, and parallel assays with well-characterized mammalian Ch25h .

How does the activity of F35C8.5 compare with mammalian Ch25h?

Comparative studies between F35C8.5 and mammalian Ch25h reveal both similarities and differences:

  • Both enzymes catalyze the conversion of cholesterol to 25OHC

  • F35C8.5 typically shows 40-60% of the specific activity observed with mammalian Ch25h

  • The C. elegans enzyme exhibits broader pH tolerance (pH 6.5-8.5 vs. pH 7.0-8.0 for mammalian)

  • Temperature optima differ (20-25°C for F35C8.5 vs. 30-37°C for mammalian Ch25h)

  • Substrate specificity studies suggest F35C8.5 may accept a wider range of sterol substrates

These differences likely reflect evolutionary adaptations to the physiological environments of each organism, with the nematode enzyme functioning at lower temperatures and potentially interacting with a more diverse set of sterols encountered in its diet .

What controls are essential when measuring the inhibitory effects of 25OHC on T cell proliferation?

When studying the immunomodulatory effects of 25OHC produced by Ch25h/F35C8.5, several critical controls are necessary:

  • Vehicle controls (ethanol or DMSO at matching concentrations)

  • Dose-response curves (typically 10-1000 nM) to distinguish between metabolic effects and cytotoxicity

  • Timing controls (25OHC added at different stages of T cell activation)

  • Cell specificity controls (comparison of effects on activated vs. resting T cells)

  • Cholesterol supplementation to demonstrate reversibility of growth inhibition

  • Genetic controls (Ch25h-knockout cells) to confirm specificity

Special attention should be paid to the timing of 25OHC addition, as the inhibitory effect is most pronounced during early activation phases of T cells when cholesterol demand is highest .

How can F35C8.5 be used as a model to study the immunoregulatory functions of Ch25h?

Despite C. elegans lacking adaptive immunity, F35C8.5 offers valuable insights into the evolutionary conservation of Ch25h functions. Researchers can:

  • Compare the catalytic mechanisms and structural features between species

  • Use C. elegans as a simplified in vivo system to study the metabolic effects of 25OHC

  • Perform heterologous expression of F35C8.5 in mammalian immune cells to assess functional conservation

  • Study the interaction between 25OHC production and fundamental cellular processes conserved across species

The absence of IL-27 and interferon signaling in C. elegans provides an opportunity to identify cytokine-independent regulatory mechanisms and essential metabolic functions of Ch25h enzymes that preceded their co-option for immunoregulatory roles .

What experimental approaches can determine how 25OHC influences cholesterol biosynthesis at the molecular level?

Investigating the molecular mechanisms of 25OHC-mediated regulation requires multiple complementary approaches:

  • Transcriptomic analysis (RNA-seq) of cells treated with 25OHC at different concentrations (10-1000 nM) to identify dose-dependent gene expression changes

  • ChIP-seq for SREBP transcription factors to confirm binding site occupancy changes upon 25OHC treatment

  • Metabolic flux analysis using isotope-labeled acetate or mevalonate to track changes in cholesterol synthesis rates

  • Proteomic analysis to identify post-translational modifications and protein-protein interactions affected by 25OHC

  • Subcellular fractionation to monitor SREBP translocation and processing

Gene expression analysis has revealed that low doses of 25OHC (10-100 nM) primarily affect cholesterol biosynthesis pathways, while higher doses (>100 nM) impact cell cycle regulation, DNA replication, and DNA repair pathways .

How can researchers distinguish between direct enzymatic functions and signaling roles of F35C8.5/Ch25h?

Distinguishing enzymatic from signaling functions requires careful experimental design:

ApproachImplementationOutcome Measured
Catalytically inactive mutantsSite-directed mutagenesis of iron-coordinating residuesSeparates enzymatic activity from structural roles
25OHC supplementationExogenous addition to Ch25h-knockout systemsIdentifies effects dependent on the metabolite
Domain deletion/swappingChimeric constructs with related enzymesMaps specific functions to protein domains
Intracellular localizationMicroscopy with fluorescent tagsCorrelates location with function
Temporal analysisTime-course measurements after stimulationDistinguishes immediate enzymatic from delayed signaling effects

These complementary approaches can help determine whether biological effects require the enzyme's catalytic activity (production of 25OHC) or involve other mechanisms such as protein-protein interactions or scaffold functions.

What strategies can improve structural studies of membrane-associated F35C8.5?

Structural characterization of membrane-associated proteins like F35C8.5 presents unique challenges requiring specialized approaches:

  • Nanodiscs or lipid bilayer mimetics to maintain the native membrane environment

  • Detergent screening for optimal solubilization while preserving structure

  • Cryo-electron microscopy rather than crystallography for membrane proteins

  • Hydrogen-deuterium exchange mass spectrometry to map protein-membrane interfaces

  • Molecular dynamics simulations to model membrane interactions

  • Solution NMR with selective isotope labeling for dynamic regions

Recent advances suggest that lipid nanodiscs provide the most native-like environment for structural studies of Ch25h family proteins, maintaining both the catalytic activity and the correct orientation of the enzyme with respect to the membrane.

What statistical approaches are recommended for analyzing dose-dependent effects of 25OHC?

When analyzing the concentration-dependent effects of 25OHC on cellular processes:

  • Use non-linear regression models for dose-response curves to determine EC50 values

  • Apply ANOVA with appropriate post-hoc tests for multi-dose comparisons

  • Implement principal component analysis for multidimensional data (e.g., transcriptomics)

  • Utilize Bayesian hierarchical models for complex experimental designs with multiple variables

  • Account for time-dependent effects through repeated measures analysis

Researchers should note that 25OHC exhibits distinct biological effects at different concentration ranges: low doses (10-100 nM) primarily affect metabolic pathways, while higher doses (>100 nM) impact cell cycle and DNA-related processes .

How should researchers approach contradictory results between in vitro and in vivo studies of F35C8.5/Ch25h function?

When facing discrepancies between in vitro and in vivo findings:

  • Evaluate the physiological relevance of in vitro conditions (concentrations, timing, cellular context)

  • Consider compensatory mechanisms that may exist in vivo but not in vitro

  • Assess the cell types and tissues involved, as effects may be cell-type specific

  • Examine the timing of measurements, as acute vs. chronic effects may differ

  • Use genetic models (knockouts, tissue-specific expression) to validate mechanisms

  • Consider species differences when extrapolating between C. elegans and mammalian systems

Additionally, researchers should consider that 25OHC produced by Ch25h affects cells differently depending on their activation state. For example, actively proliferating T cells are highly sensitive to 25OHC-mediated growth inhibition, while resting T cells remain unaffected .

What are the most common pitfalls in recombinant F35C8.5 expression and how can they be addressed?

Common challenges in F35C8.5 expression include:

ChallengeIndicatorsSolutions
Protein misfoldingLow activity, aggregationLower expression temperature, fusion tags, chaperone co-expression
Proteolytic degradationMultiple bands on SDS-PAGEProtease inhibitors, optimize harvest timing, use protease-deficient strains
Poor solubilityProtein in inclusion bodiesDetergent screening, refolding protocols, truncation constructs
Low yieldMinimal protein expressionCodon optimization, alternate promoters, different host strains
Inactive proteinPurified protein with no activityInclude reducing agents, optimize purification conditions, avoid multiple freeze-thaw cycles

For membrane-associated proteins like F35C8.5, maintaining the proper lipid environment throughout purification is critical for preserving enzymatic activity. Supplementing buffers with specific phospholipids or cholesterol can help stabilize the protein and maintain its native conformation.

How might targeted modifications of F35C8.5 enhance its utility as a research tool?

Strategic engineering of F35C8.5 could create valuable research tools:

  • Fluorescent protein fusions for real-time localization studies

  • Split-protein complementation systems to study protein-protein interactions

  • Substrate specificity modifications to create selective oxysterol-producing enzymes

  • Inducible activity variants responsive to external stimuli

  • Catalytic enhancement through directed evolution

  • Chimeric constructs combining domains from F35C8.5 and mammalian Ch25h

These modified versions would enable more sophisticated investigations into the roles of 25OHC in cellular metabolism and immune regulation, potentially leading to novel therapeutic approaches targeting cholesterol metabolism.

What are the current knowledge gaps regarding the role of F35C8.5 in C. elegans physiology?

Despite advances in understanding mammalian Ch25h, several questions remain about F35C8.5:

  • The endogenous regulators of F35C8.5 expression in C. elegans

  • The complete metabolic pathway of 25OHC in nematodes

  • Physiological roles of 25OHC in C. elegans development and stress responses

  • Potential interactions between F35C8.5 and innate immune pathways in C. elegans

  • Tissue-specific expression patterns and their functional significance

  • The role of F35C8.5 in the context of the simplified C. elegans sterol metabolism

Addressing these gaps will provide evolutionary context for understanding the fundamental roles of Ch25h enzymes across species.

How can structural comparisons between F35C8.5 and mammalian Ch25h inform therapeutic development?

Comparative structural analysis offers several advantages:

  • Identification of conserved catalytic residues essential for function

  • Mapping of species-specific structural differences that might be exploited for selective targeting

  • Understanding substrate-binding determinants to guide inhibitor design

  • Elucidation of membrane interaction domains that influence enzyme activity

  • Insight into protein dynamics through comparative molecular dynamics simulations

This information can guide the development of modulators of Ch25h activity with potential applications in inflammatory and autoimmune conditions, where inappropriate T cell responses contribute to pathology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.