Recombinant Chondrus crispus Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COX2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Chondrus crispus (Carrageen Irish moss) (Polymorpha crispa)
Target Names
COX2
Target Protein Sequence
MNNILNFYPAVITTDVAENWQIGFQDPATPIMEGIINLHYDLMFFICVISVFVSWMLGRT LWHFEQNQNKIPSSLTHGTLIEMIWTVTPAFILLIIAVPSFSLLYAMDEIISPAITIKTL GHQWYWSYEYSDYLNEDDDSINYDSYMIPEEDLEIGQFRLLEVDNRMVIPINTHIRVIVT AADVLHSWAVPSFRSKCDAIPGRLNQTSLFIKREGVYYGQCSEICGINHGFMPIVVEATS LPNYVSWISNKLNE
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising Complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. COX2 plays a crucial role in this process, contributing to the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the copper A center (CuA) and heme A to the binuclear center (BNC), consisting of heme a3 and copper B (CuB). The BNC catalyzes the four-electron reduction of oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Chondrus crispus COX2 and what is its functional significance?

Chondrus crispus (red algae) COX2 is one of the core subunits of mitochondrial cytochrome c oxidase (Cco), containing a dual core CuA active site. The protein plays a significant role in physiological processes, particularly energy metabolism within the mitochondrial respiratory chain . As a component of cytochrome c oxidase, COX2 participates in the terminal step of the electron transport chain, catalyzing the reduction of oxygen to water while contributing to the generation of a proton gradient necessary for ATP synthesis .

In red algae like Chondrus crispus, the protein has evolved distinctive characteristics that may reflect adaptations to marine environments. The Chondrus crispus COX2 protein (accession number XP_005713760) is approximately 474 amino acids in length and contains copper oxidase type 2-like domains that are critical for its catalytic function .

What are the recommended expression systems for recombinant Chondrus crispus COX2?

Based on successful heterologous expression of COX2 proteins from other organisms, the E. coli Transetta (DE3) expression system represents a robust platform for recombinant Chondrus crispus COX2 production. The methodology involves:

  • Cloning the full-length cDNA of the COX2 gene into an expression vector such as pET-32a

  • Transformation into E. coli Transetta (DE3) cells

  • Induction of protein expression with isopropyl β-D-thiogalactopyranoside (IPTG)

  • Purification of the recombinant protein using affinity chromatography (typically with Ni²⁺-NTA agarose for His-tagged constructs)

The purified recombinant protein can then be verified using Western blotting and functional assays to confirm its activity. When designing expression constructs, researchers should consider incorporating a removable His-tag to facilitate purification while allowing subsequent tag removal to study the native protein function .

What sequence characteristics should researchers verify when working with Chondrus crispus COX2?

When working with Chondrus crispus COX2, researchers should verify:

  • The complete open reading frame (ORF) encoding the full-length protein (approximately 474 amino acids)

  • The presence of conserved motifs typical of COX2 proteins, particularly the copper-binding domains

  • Sequence identity with other COX2 proteins through multiple sequence alignment

  • The presence of conserved heme-binding motifs such as CXXCH that are critical for cytochrome c function

Multiple sequence alignment with other species' COX2 proteins is essential to confirm the identity and integrity of the cloned sequence. Phylogenetic analysis can also provide insights into the evolutionary relationship of Chondrus crispus COX2 with other algal and non-algal species .

What are the optimal conditions for recombinant Chondrus crispus COX2 expression and purification?

Based on successful approaches with other COX2 proteins, the following parameters are recommended:

ParameterOptimal ConditionNotes
Expression vectorpET-32a or similarProvides strong T7 promoter control and fusion tags
Host strainE. coli Transetta (DE3)Enhances expression of eukaryotic proteins
Induction temperature16-20°CLower temperatures reduce inclusion body formation
IPTG concentration0.5-1.0 mMOptimal concentration should be determined empirically
Induction duration16-20 hoursExtended time at lower temperature increases soluble protein yield
Lysis buffer50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSFProtease inhibitors are essential
Purification methodNi²⁺-NTA affinity chromatographyFor His-tagged constructs
Elution conditions250-300 mM imidazoleGradient elution recommended

After purification, dialysis against a suitable buffer (typically 50 mM Tris-HCl, pH 7.5, 150 mM NaCl) is recommended to remove imidazole. The purified protein concentration can be determined using UV-spectrophotometry, with expected yields around 50 μg/mL of culture, based on similar recombinant protein expression systems .

How can researchers assess the enzymatic activity of purified recombinant Chondrus crispus COX2?

Enzymatic activity of recombinant COX2 can be assessed through:

  • Cytochrome c oxidation assay: Measuring the ability of COX2 to catalyze the oxidation of reduced cytochrome c as substrate using UV-spectrophotometry. This can be monitored by following the decrease in absorbance at 550 nm as reduced cytochrome c is oxidized .

  • Oxygen consumption measurement: Using oxygen electrodes to measure oxygen consumption rates in the presence of reduced cytochrome c and the purified recombinant COX2.

  • Spectroscopic characterization: Infrared and UV-visible spectroscopy can provide insights into the structural integrity and functional properties of the recombinant protein, particularly regarding its ability to interact with substrates .

The enzymatic activity should be compared with native COX2 or recombinant COX2 from related species to establish baseline activity levels. Temperature, pH, and buffer composition significantly affect enzymatic activity and should be optimized empirically for the Chondrus crispus protein .

What molecular techniques are recommended for analyzing Chondrus crispus COX2 genetic variation?

For analyzing genetic variation in Chondrus crispus COX2, the following approaches are recommended:

  • PCR amplification and sequencing: Design primers targeting conserved regions of the COX2 gene. Based on studies with other organisms, this approach typically achieves >94% success in amplification and sequencing of fresh specimens .

  • Haplotype characterization: COX2 has been shown to be a useful marker for haplotype identification in other species, though it tends to be less variable than COX1. Using multiple markers in combination (such as COX2+rbcL) can provide more robust phylogenetic assessment .

  • Automated species partitioning analysis (ASAP): This method can effectively identify operational taxonomic units (OTUs) based on COX2 sequence data .

  • Multiple sequence alignment (MSA): Tools such as MUSCLE are effective for COX2 sequence alignment before phylogenetic analysis .

When working with historical or herbarium specimens, it's notable that partial COX2 sequences can often be successfully retrieved from samples as old as 12-16 years, making this gene useful for temporal studies of genetic variation .

How can site-directed mutagenesis of Chondrus crispus COX2 reveal structure-function relationships?

Site-directed mutagenesis offers powerful insights into COX2 structure-function relationships. Key approaches include:

  • Targeting conserved catalytic residues: Mutations in the copper-binding sites can reveal the role of specific amino acids in electron transfer and catalytic function. The dual core CuA active site is particularly important for investigation .

  • Probing potential binding sites: Molecular docking methods coupled with strategic mutations can identify important interaction sites. For example, studies with other COX2 proteins have identified specific residues (such as Leu-31) that form hydrogen bonds with substrates or inhibitors like allyl isothiocyanate (AITC) .

  • Investigating species-specific variations: Comparing the effects of mutations at positions that differ between Chondrus crispus and other species can reveal adaptations specific to red algae.

The mutational analysis should follow a systematic approach:

  • Generate point mutations using PCR-based methods

  • Express and purify mutant proteins following the same protocols used for wild-type

  • Compare enzymatic activities and binding affinities

  • Perform structural analysis using spectroscopic methods

  • Correlate functional changes with structural predictions from molecular modeling

What insights can phylogenetic analysis of Chondrus crispus COX2 provide about evolutionary relationships?

Phylogenetic analysis of COX2 can provide valuable evolutionary insights:

  • Molecular clock applications: COX2 sequences evolve at rates that make them useful for inferring evolutionary relationships. Analysis of synonymous and non-synonymous substitution rates can reveal selective pressures on the gene .

  • Multiple marker approaches: Combining COX2 with other markers improves phylogenetic resolution. Recommended combinations include cox1+rbcL, COB+rbcL, or cox2+rbcL for cost-effective phylogenetic inference with consistently high nodal support .

  • Conservation analysis: Neutrality tests on COX2 sequences can reveal whether the gene has been conserved throughout evolution or has undergone adaptive changes. For example, in giant pandas, the COX2 gene showed conservation throughout evolution with specific clustering patterns suggesting different evolutionary paths compared to other Ursidae species .

For robust phylogenetic analysis, maximum likelihood methods with appropriate nucleotide substitution models are recommended, using homologous sequences from related species as references. This approach can uncover potential cryptic species or confirm the monophyly of currently accepted taxa .

How does post-translational modification affect Chondrus crispus COX2 function?

Post-translational modifications (PTMs) significantly impact COX2 function. Key considerations include:

  • Heme attachment: The covalent attachment of heme to cytochrome c occurs through a complex maturation process. In red algae like Chondrus crispus, this likely involves System II cytochrome c maturation machinery, which includes proteins such as CcsA, CcsB, CcsX, and CcdA .

  • Thioester bond formation: The formation of thioester bonds between heme and cysteine residues in the CXXCH heme-binding motif is crucial for function. These bonds must be properly formed for the protein to be catalytically active .

  • Redox state maintenance: The reduction state of cysteine residues in the CXXCH motif is crucial and is maintained by thioredoxin-like proteins in the maturation system .

When working with recombinant systems, researchers should consider that E. coli may not correctly perform all PTMs required for full Chondrus crispus COX2 function. Alternative expression systems, such as yeast or algal systems, might be necessary if proper PTMs are critical for the research question being addressed .

How does Chondrus crispus COX2 differ from other algal COX2 proteins in structure and function?

Comparative analysis reveals several distinctive features of Chondrus crispus COX2:

  • Sequence divergence: While maintaining core functional domains, Chondrus crispus COX2 shows specific sequence adaptations that may reflect its evolutionary history as a red alga. These adaptations could be related to the unique ecological niche occupied by this species .

  • Size variation: The Chondrus crispus COX2 protein (approximately 474 amino acids) is larger than typical animal COX2 proteins, which are often around 227 amino acids . This size difference suggests potential additional functional domains or structural elements.

  • Substrate specificity: Different algal species show variations in cytochrome c oxidase kinetics and substrate specificity. These differences can be quantified through enzyme kinetics studies comparing recombinant COX2 proteins from different algal sources .

The functional significance of these differences can be investigated through protein domain swapping experiments, where specific regions of Chondrus crispus COX2 are exchanged with corresponding regions from other species to identify domains responsible for functional divergence .

What are the challenges in applying findings from model organisms' COX2 studies to Chondrus crispus research?

Several challenges exist when translating COX2 research from model organisms to Chondrus crispus:

  • Evolutionary distance: Chondrus crispus, as a red alga, is evolutionarily distant from common model organisms, potentially limiting the applicability of findings from studies on animal or bacterial systems .

  • Cellular compartmentalization differences: The subcellular organization and compartmentalization of energy metabolism pathways differ between algae and other eukaryotes, potentially affecting COX2 function and regulation .

  • Environmental adaptations: As a marine organism, Chondrus crispus has evolved under different selective pressures than terrestrial or freshwater model organisms, potentially leading to unique adaptations in its respiratory machinery .

  • Technical limitations: Genetic manipulation techniques well-established in model organisms may require significant optimization for Chondrus crispus. This includes transformation methods, gene knockout strategies, and expression systems .

To address these challenges, researchers should develop Chondrus crispus-specific tools and protocols rather than directly applying methods optimized for model organisms. Additionally, comparative studies should include closely related red algal species to better contextualize findings .

What strategies can resolve poor expression or incorrect folding of recombinant Chondrus crispus COX2?

When encountering expression or folding issues with recombinant Chondrus crispus COX2, consider these approaches:

ProblemPotential SolutionsRationale
Insoluble protein/inclusion bodies- Lower induction temperature (16°C)
- Reduce IPTG concentration
- Co-express with chaperones
- Use solubility-enhancing fusion tags
Slower expression promotes proper folding; chaperones assist folding
Low expression levels- Optimize codon usage for E. coli
- Try different E. coli strains
- Change vector systems
- Optimize media composition
Codon optimization can increase translation efficiency
Protein degradation- Add protease inhibitors
- Use protease-deficient host strains
- Optimize purification time and temperature
Minimizes proteolytic degradation during extraction
Incorrect disulfide bond formation- Express in specialized strains (SHuffle)
- Include redox reagents in lysis buffer
- Consider periplasmic expression
Promotes proper disulfide bond formation
Lack of cofactor incorporation- Supplement growth media with heme
- Consider expression in eukaryotic systems
Ensures availability of necessary cofactors

Additionally, screening multiple construct designs with various truncations or fusion partners can help identify the optimal expression strategy. For particularly challenging constructs, cell-free expression systems might provide an alternative approach .

How can researchers address inconsistent enzymatic activity in purified Chondrus crispus COX2 preparations?

Inconsistent enzymatic activity can be addressed through:

  • Quality control measures:

    • Verify protein integrity by SDS-PAGE and mass spectrometry

    • Confirm proper folding using circular dichroism spectroscopy

    • Assess cofactor incorporation with UV-visible spectroscopy

  • Buffer optimization:

    • Test multiple buffer compositions and pH values

    • Include stabilizing agents (glycerol, reducing agents)

    • Consider additives like copper ions to ensure full occupation of the CuA site

  • Substrate preparation standardization:

    • Ensure consistent preparation of reduced cytochrome c substrate

    • Standardize the redox state of cytochrome c using precise reduction protocols

    • Verify substrate quality before each assay

  • Assay condition control:

    • Maintain strict temperature control during assays

    • Standardize oxygen levels in oxygen consumption measurements

    • Use consistent protein concentrations across experiments

  • Storage optimization:

    • Determine optimal storage conditions (temperature, buffer composition)

    • Test protein stability over time under various storage conditions

    • Consider flash-freezing aliquots in liquid nitrogen with cryoprotectants

What are promising applications of Chondrus crispus COX2 in structural biology research?

Structural biology research on Chondrus crispus COX2 offers several promising directions:

  • Comparative structural analysis: Resolving the three-dimensional structure of Chondrus crispus COX2 would allow comparison with homologs from other species, potentially revealing adaptations specific to red algae. X-ray crystallography or cryo-electron microscopy approaches would be suitable for this purpose .

  • Cofactor-protein interactions: Detailed structural studies can elucidate how the CuA center in Chondrus crispus COX2 interacts with its environment and how these interactions might differ from those in other organisms. Spectroscopic methods such as EPR could provide insights into the electronic structure of the copper centers .

  • Membrane protein complex assembly: As part of the cytochrome c oxidase complex, structural studies on COX2 could reveal how respiratory complexes are assembled and organized in red algal membranes, potentially identifying unique features compared to other eukaryotes .

  • Molecular dynamics simulations: Computational approaches can provide insights into protein dynamics, particularly regarding substrate binding, electron transfer pathways, and conformational changes during catalysis .

These structural studies would benefit from expressing and purifying sufficient quantities of homogeneous recombinant protein, possibly requiring optimization of expression systems beyond E. coli, such as yeast or algal expression platforms .

How might CRISPR-Cas9 genome editing advance functional studies of Chondrus crispus COX2?

CRISPR-Cas9 technology offers transformative potential for Chondrus crispus COX2 research:

  • In vivo functional validation: Direct editing of the COX2 gene in Chondrus crispus would allow validation of structure-function relationships identified through recombinant protein studies. This could include creating specific point mutations to assess their effects on respiratory efficiency and growth .

  • Regulatory element analysis: CRISPR-based approaches could be used to modify promoter regions or other regulatory elements controlling COX2 expression, providing insights into how this gene is regulated under different environmental conditions .

  • Tagged variant generation: Insertion of epitope tags or fluorescent proteins at the genomic level would enable tracking of COX2 localization, turnover, and interactions without overexpression artifacts .

  • Adaptation studies: Creating variant strains with COX2 modifications could reveal how specific amino acid changes affect adaptation to different environmental conditions, such as temperature, light intensity, or oxygen availability .

The development of efficient transformation protocols for Chondrus crispus would be a prerequisite for these applications. Building on selection techniques already established for other algal species would be a logical starting point for this development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.