Recombinant Chondrus crispus Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Chondrus crispus Cytochrome c Oxidase Subunit 3 (COX3)

Recombinant Chondrus crispus COX3 is a mitochondrial protein expressed in E. coli as part of cytochrome c oxidase (COX), the terminal enzyme in the electron transport chain. COX3 (UniProt ID: P48872) is a nuclear-encoded subunit critical for oxidative phosphorylation, enabling ATP synthesis via proton gradient utilization . The recombinant form includes an N-terminal His tag for purification and spans the full-length sequence (1–272 amino acids) .

Key Features

ParameterDescriptionSource
SequenceFull-length (1–272 aa), includes conserved motifs for heme binding and proton translocation
Genetic CodeUGA encodes tryptophan (mtDNA-specific code, unlike green plants)
Phylogenetic LinkShares ancestry with green plant mitochondria but retains non-plant features (e.g., small mitochondrial genome)
RNA EditingAbsent in COX3 transcripts, unlike some mitochondrial genes

Expression System

  • Host Organism: E. coli (e.g., BL21(DE3))

  • Tag: N-terminal His tag for affinity chromatography

  • Purity: >90% as validated by SDS-PAGE

Evolutionary Significance

COX3 in Chondrus crispus bridges mitochondrial evolution between red algae and green plants:

  • Phylogenetic Position: Shares immediate ancestry with green plant mitochondria but retains a modified genetic code .

  • Cytochrome c Maturation: Recurrent shifts from system I to system III (holocytochrome c synthase, HCCS) in archaeplastids highlight functional divergence. Chondrus COX3 homologs enable functional complementation in yeast and Arabidopsis mutants .

Experimental Findings

Study FocusKey ResultsSource
Respiratory FunctionChlamydomonas HCCS mutants show impaired growth and reduced cytochrome c-dependent respiration
Biochemical RescueC. crispus HCCS homologs restore aerobic respiration in yeast ∆cyc3 mutants
Metabolic ImpactAltered metabolic flux in mutants, linked to defective CCM pathways

Comparative Analysis with Other COX3 Homologs

OrganismSequence Identity (%)Mitochondrial FeaturesSource
Chondrus crispusN/ASmall genome, UGA=Trp, no RNA editing
Arabidopsis thaliana~40%Standard genetic code, system I-dependent CCM
Homo sapiens~35%Complex genome, RNA editing prevalent

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific requests. Please specify your preferred format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
COX3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Chondrus crispus (Carrageen Irish moss) (Polymorpha crispa)
Target Names
COX3
Target Protein Sequence
MTTLSQISKSVQRHPFHLVDPSPWPFVASLCAFSCAIGGVMYMHAYVNGSFILSISFFCL LLVMFTWWRDVIRESTFEGHHTGIVQQGLRFGVILFIISEILFFFAFFWAFFHSSLAPTI EIGSIWPPKGINVLNPWEIPFLNTLILLLSGCTVTWCHHSLVSNLRNQSVLSLFLTIVLA IVFTTFQAYEYSMADFRLSDGIYGSTFYMATGFHGFHVLVGTISLAVCLIRLLQYQLTQQ HHFGFESAAWYWHFVDVVWLFLFVSIYWWGGS
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work together to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase is the respiratory chain component that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Database Links
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and genomic organization of Chondrus crispus COX3?

Chondrus crispus COX3 is encoded by the mitochondrial cox3 gene, representing the first characterized mitochondrial gene from a red alga. The protein functions as a multi-pass membrane component of the cytochrome c oxidase complex, a terminal enzyme in the mitochondrial electron transport chain. The gene encodes subunit 3 of cytochrome c oxidase, which plays a critical role in cellular respiration . Structurally, COX3 is integrated into the inner mitochondrial membrane where it contributes to proton pumping and electron transfer functions essential for ATP production.

When working with this protein, researchers should note that comprehensive sequence analysis has revealed significant phylogenetic importance, as the nucleotide and amino acid sequences demonstrate evolutionary relationships between red algae and green plants, despite differences in genetic code usage .

How does Chondrus crispus COX3 differ from other eukaryotic COX3 proteins?

The COX3 protein from Chondrus crispus exhibits several distinctive features compared to its counterparts in other eukaryotes. A key difference lies in its genetic code usage, where the UGA codon specifies tryptophan rather than functioning as a stop codon, similar to most non-plant mitochondrial systems . This represents a deviation from the genetic code used in green plant mitochondria.

Despite this difference in genetic code, phylogenetic analyses of both nucleotide and amino acid sequences place C. crispus COX3 within the green-plant mitochondrial lineage, creating an interesting evolutionary paradox . This dual characteristic—having both plant-like ancestry and non-plant mitochondrial features—positions rhodophytes like C. crispus as potential evolutionary intermediates at the root of the green plant mitochondrial lineage. Additionally, C. crispus mitochondria have a relatively small-sized genome compared to land plants, further distinguishing its evolutionary position.

What techniques are essential for isolating and expressing recombinant Chondrus crispus COX3?

The isolation and expression of recombinant Chondrus crispus COX3 requires specialized approaches due to its membrane-bound nature and mitochondrial origin. Based on analogous protocols for similar proteins, the following methodological workflow is recommended:

  • Gene Cloning and Optimization: The cox3 gene should be PCR-amplified using primers designed based on the published sequence (GenBank). For recombinant expression, codon optimization may be necessary, particularly accounting for the alternative genetic code where UGA encodes tryptophan .

  • Expression System Selection: Insect cell expression systems (such as Sf9 cells with baculovirus vectors) have proven effective for expressing membrane-bound mitochondrial proteins. This approach allows for proper protein folding and post-translational modifications .

  • Expression Verification: Expression can be confirmed using RT-PCR similar to approaches described for related proteins, using primers corresponding to the coding region of the gene .

  • Protein Detection: Western blotting with antibodies specific to conserved COX3 epitopes can be employed. For enhanced specificity, custom antibodies against C. crispus COX3-specific peptides may be developed .

  • Functional Assessment: Activity assays measuring electron transfer capability or oxygen consumption can verify functional integrity of the recombinant protein.

How can Chondrus crispus COX3 be utilized to investigate mitochondrial evolution in photosynthetic organisms?

Chondrus crispus COX3 represents an exceptional model for investigating mitochondrial evolution due to its unique position in the evolutionary tree. Research applications include:

  • Comparative Genomic Studies: The C. crispus cox3 gene demonstrates a fascinating evolutionary duality—phylogenetically related to green plants while utilizing a genetic code characteristic of non-plant organisms . This makes it invaluable for investigating the evolution of genetic code alterations across eukaryotic lineages.

  • Ancestral Sequence Reconstruction: Using C. crispus COX3 sequences alongside those from diverse lineages enables the reconstruction of ancestral mitochondrial proteins, providing insights into the evolutionary trajectory of respiratory complexes.

  • Analysis of Selection Pressures: The conservation pattern of functional domains versus variable regions in C. crispus COX3 compared to other organisms can reveal selection pressures unique to red algal mitochondria.

  • Endosymbiotic Event Investigation: As rhodophytes may represent an intermediate evolutionary link, C. crispus COX3 can be used to study the early divergence of plant and non-plant mitochondrial lineages following the primary endosymbiotic event .

When designing such evolutionary studies, researchers should incorporate multiple phylogenetic algorithms and models to account for the unique evolutionary rate and selective pressures that may affect mitochondrial genes in different lineages.

What experimental challenges exist when studying post-translational modifications of Chondrus crispus COX3?

Investigating post-translational modifications (PTMs) of Chondrus crispus COX3 presents several technical challenges that researchers should anticipate:

  • Glycosylation Analysis: As demonstrated with related COX proteins, glycosylation can be critical for enzymatic activity . For C. crispus COX3, researchers should implement differential glycosylation assessment using tunicamycin treatment of expression systems followed by activity assays.

  • Membrane Protein Isolation: The integral membrane nature of COX3 necessitates specialized extraction protocols using non-denaturing detergents to maintain structural integrity.

  • Site-Specific Modification Mapping: Mass spectrometry approaches must be optimized for hydrophobic proteins to accurately identify modification sites. A combination of multiple proteases is recommended to achieve comprehensive sequence coverage.

  • Functional Impact Assessment: Correlating identified PTMs with functional changes requires both in vitro activity assays and potentially in vivo complementation studies in model systems with COX3 deficiencies.

  • Species-Specific Differences: Researchers must account for potential differences in the PTM machinery between C. crispus and expression host systems when interpreting results.

A recommended experimental approach would combine site-directed mutagenesis of potential modification sites with functional assays to establish causality between specific PTMs and protein function.

How does the genetic code variation in Chondrus crispus COX3 affect experimental design for recombinant expression?

The alternative genetic code usage in Chondrus crispus mitochondria, where UGA encodes tryptophan rather than serving as a stop codon, creates several important considerations for recombinant expression :

  • Expression Vector Design: Standard expression vectors must be modified to properly translate UGA codons as tryptophan rather than terminating translation. This requires either codon optimization to replace UGA with UGG (standard tryptophan codon) or expression in systems engineered with modified translation machinery.

  • Host Selection Considerations: The choice of expression host becomes critical. While bacterial systems typically interpret UGA as a stop codon, some eukaryotic systems may be more amenable to alternative genetic codes with appropriate modifications.

  • Translation Efficiency Assessment: Researchers should monitor for premature termination products and implement western blot analysis to verify full-length protein production.

  • Mutagenesis Strategy: For structure-function studies involving tryptophan residues, researchers must be particularly careful with codon selection when designing mutagenesis primers.

  • Heterologous Expression Optimization: Based on successful approaches with similar membrane proteins, insect cell expression systems with baculovirus vectors have proven effective and may be adapted for C. crispus COX3 expression .

A systematic approach comparing expression efficiency across multiple systems, coupled with functional validation, is recommended to overcome these genetic code challenges.

What are the optimal conditions for functional characterization of recombinant Chondrus crispus COX3?

The functional characterization of recombinant Chondrus crispus COX3 requires careful optimization of multiple parameters:

  • Membrane Reconstitution: For activity assays, the protein should be reconstituted in liposomes with a lipid composition mimicking the mitochondrial inner membrane, typically containing cardiolipin.

  • Assay Conditions: Optimal conditions should include physiologically relevant pH (7.2-7.4), temperature (15-20°C reflecting the marine environment of C. crispus), and appropriate electron donors and acceptors.

  • Activity Measurement: Oxygen consumption rates can be measured using polarographic methods with a Clark-type electrode, while electron transfer activity can be assessed spectrophotometrically by monitoring cytochrome c oxidation.

  • Complex Assembly: Since COX3 functions as part of the larger cytochrome c oxidase complex, co-expression with other subunits may be necessary for proper folding and full activity.

  • Inhibitor Sensitivity Profiling: Establishing the sensitivity profile to standard cytochrome c oxidase inhibitors helps validate the functional integrity of the recombinant protein.

When implementing these assays, researchers should include appropriate controls, including COX3 proteins from well-characterized species, to benchmark the functional parameters of C. crispus COX3.

How can researchers effectively analyze the evolutionary relationship between Chondrus crispus COX3 and other eukaryotic homologs?

To effectively analyze evolutionary relationships of Chondrus crispus COX3, researchers should implement a multi-faceted phylogenetic approach:

  • Sequence Data Collection: Compile a comprehensive dataset of COX3 sequences from diverse eukaryotic lineages, ensuring balanced representation across taxonomic groups.

  • Multiple Sequence Alignment: Use structural information to guide alignments, accounting for conserved transmembrane domains. Employ multiple alignment algorithms (e.g., MUSCLE, MAFFT, T-Coffee) and compare results to identify consistently aligned regions.

  • Phylogenetic Model Selection: Test multiple evolutionary models using likelihood ratio tests or Bayesian information criteria to identify those that best fit the data.

  • Tree Construction Methods: Apply multiple methods including Maximum Likelihood, Bayesian Inference, and Distance methods, then compare topologies to identify consistent evolutionary patterns.

  • Statistical Support Assessment: Implement bootstrap analysis (>1000 replicates) and posterior probability calculations to evaluate the statistical support for key nodes.

This approach has revealed that despite using a non-plant mitochondrial genetic code, C. crispus COX3 shows phylogenetic affinity with the green plant mitochondrial lineage, suggesting a complex evolutionary history . This positions rhodophytes as potential evolutionary intermediates between plant and non-plant mitochondrial lineages.

What techniques can effectively distinguish Chondrus crispus COX3 from other cytochrome c oxidase subunits in complex samples?

Distinguishing Chondrus crispus COX3 from other cytochrome oxidase subunits in complex samples requires specialized techniques tailored to its unique properties:

  • Immunological Approaches: Development of specific antibodies targeting unique epitopes of C. crispus COX3. The recommended approach involves designing synthetic peptides corresponding to regions with low sequence conservation across other subunits, coupling to carrier proteins, and immunization in rabbits .

  • Mass Spectrometry-Based Identification: Implementation of targeted proteomics approaches using selected reaction monitoring (SRM) to detect signature peptides unique to C. crispus COX3.

  • Separation Techniques: Two-dimensional blue native/SDS-PAGE electrophoresis can effectively separate individual components of respiratory complexes while preserving native interactions.

  • Genetic Tagging: For recombinant studies, introduction of epitope tags or fluorescent protein fusions at non-critical domains can facilitate specific detection without compromising function.

  • RNA-Based Detection: Design of specific RT-PCR primers and northern blot probes targeting unique regions of the cox3 transcript, particularly intron-exon boundaries .

When combining these approaches, researchers should validate specificity using appropriate controls, including samples lacking C. crispus mitochondrial proteins and those containing known quantities of purified recombinant protein.

How might Chondrus crispus COX3 research contribute to understanding mitochondrial disorders in humans?

Research on Chondrus crispus COX3 offers several potential contributions to understanding human mitochondrial disorders:

  • Evolutionary Conservation Analysis: By comparing functionally critical regions between C. crispus and human COX3, researchers can identify highly conserved domains likely essential for function across evolutionary distance. Mutations in these regions in human mitochondrial DNA may have particularly severe phenotypic consequences.

  • Structure-Function Relationships: The unique evolutionary position of C. crispus COX3 provides an additional reference point for understanding structure-function relationships in cytochrome c oxidase. This comparative approach can help interpret the impact of novel mutations identified in patients with mitochondrial disorders.

  • Pathogenic Mutation Modeling: Recombinant C. crispus COX3 can serve as an alternative model system for introducing and studying the functional effects of mutations analogous to those found in human mitochondrial disorders such as Leber hereditary optic neuropathy (LHON), mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes (MELAS), and cytochrome c oxidase deficiency .

  • Mitochondrial Genetic Code Evolution: The alternative genetic code usage in C. crispus mitochondria provides insights into the evolution and maintenance of genetic code variations, which has implications for understanding certain mitochondrial diseases caused by mutations affecting tRNA genes and translation machinery.

When pursuing these research directions, investigators should carefully account for the physiological differences between algal and human systems while focusing on conserved mechanistic aspects.

What are the key considerations when designing inhibitor studies for Chondrus crispus COX3?

When designing inhibitor studies for Chondrus crispus COX3, researchers should consider several critical factors:

  • Inhibitor Selection: Choose a diverse panel of known cytochrome c oxidase inhibitors with different mechanisms of action (e.g., heme-binding, copper-binding, and allosteric inhibitors).

  • Species-Specific Differences: Anticipate potential differences in inhibitor sensitivity between C. crispus COX3 and better-characterized homologs from other species. This may require testing a wider concentration range and establishing complete inhibition curves.

  • Experimental Design for IC50 Determination: Implement rigorous dose-response studies similar to those shown for other enzymes in Table 1 , using multiple inhibitor concentrations to accurately determine IC50 values:

Inhibitor TypeConcentration Range (μM)ControlsAssay Conditions
Heme-binding0.001-1000Human COX330 μM substrate, pH 7.4
Copper-binding0.001-1000Human COX330 μM substrate, pH 7.4
Allosteric0.1-1000Human COX330 μM substrate, pH 7.4
Novel compounds0.001-1000Human COX330 μM substrate, pH 7.4
  • Activity Assay Optimization: Ensure that inhibition assays properly measure COX3-specific activity rather than general mitochondrial function.

  • Specificity Controls: Include appropriate control experiments to distinguish between specific inhibition of COX3 and non-specific effects on membrane integrity or other components of the respiratory chain.

This methodological approach will enable the development of a comprehensive inhibition profile for C. crispus COX3, potentially revealing unique structural and functional properties of this evolutionary significant enzyme.

How can the study of Chondrus crispus COX3 inform our understanding of adaptation to different oxygen environments?

The study of Chondrus crispus COX3 offers valuable insights into evolutionary adaptations to varying oxygen environments, particularly in marine ecosystems:

  • Environmental Adaptation Analysis: C. crispus inhabits intertidal zones where oxygen availability fluctuates dramatically with tidal cycles. Analysis of its COX3 structure and function compared to terrestrial organisms may reveal adaptations to variable oxygen tension.

  • Comparative Kinetic Studies: Oxygen binding and consumption kinetics of recombinant C. crispus COX3 can be compared with homologs from organisms adapted to different oxygen environments. Key parameters to measure include Km for oxygen, catalytic efficiency, and potential allosteric regulations.

  • Molecular Evolution Approach: Identification of positively selected amino acid sites in C. crispus COX3 through comparative sequence analysis may highlight positions involved in environmental adaptation.

  • Expression Regulation Analysis: Investigation of transcriptional and post-transcriptional regulation of cox3 expression in response to changing oxygen levels can reveal regulatory adaptations specific to the intertidal environment.

  • Structure-Function Correlations: Correlation of structural features unique to C. crispus COX3 with functional parameters under varying oxygen concentrations may identify critical adaptations.

This research direction has broader implications for understanding how fundamental energy-generating processes adapt to environmental challenges, potentially informing both evolutionary biology and biotechnological applications related to oxygen sensing and utilization.

What strategies can overcome expression difficulties when producing recombinant Chondrus crispus COX3?

Researchers often encounter challenges when expressing recombinant Chondrus crispus COX3 due to its membrane protein nature and alternative genetic code. The following strategies can address these issues:

  • Genetic Code Adaptation: Modify expression constructs to account for the alternative mitochondrial genetic code where UGA codons encode tryptophan instead of serving as stop codons . This can be accomplished through site-directed mutagenesis to replace UGA with UGG codons.

  • Expression System Selection: Based on successful approaches with similar proteins, insect cell expression systems using baculovirus vectors at a multiplicity of infection (MOI) of 3 have proven effective for membrane-bound respiratory proteins . Alternative systems include yeast (S. cerevisiae or P. pastoris) with inducible promoters.

  • Fusion Tag Optimization: Test multiple fusion tags (His, GST, MBP) positioned at either N- or C-terminus to identify configurations that improve folding while maintaining function.

  • Protein Solubilization: For extraction and purification, screen a panel of detergents (including digitonin, DDM, and CHAPS) at various concentrations to optimize solubilization while preserving native structure.

  • Co-expression Strategies: Consider co-expressing with other cytochrome c oxidase subunits or mitochondrial chaperones to facilitate proper complex assembly and stability.

When implementing these strategies, researchers should verify expression through multiple methods including western blotting, activity assays, and mass spectrometry to ensure production of full-length, properly folded protein.

How can researchers address the challenge of properly interpreting phylogenetic analyses of Chondrus crispus COX3?

The phylogenetic analysis of Chondrus crispus COX3 presents several interpretive challenges that researchers should address methodically:

  • Long-Branch Attraction Artifact Assessment: The evolutionary distance between red algae and other lineages can create long-branch attraction artifacts. Researchers should implement phylogenetic methods resistant to these artifacts, such as CAT models in Bayesian analyses, and test multiple outgroup configurations.

  • Nucleotide vs. Amino Acid Analysis Comparison: Conduct parallel analyses using both nucleotide and amino acid sequences. The findings that C. crispus COX3 shows relationship to green plant mitochondrial lineage at both levels strengthens confidence in this evolutionary connection .

  • Saturation Analysis: Perform substitution saturation tests to determine whether the phylogenetic signal remains informative across the evolutionary distances involved.

  • Alternative Topology Testing: Statistically evaluate alternative tree topologies using approaches such as approximately unbiased (AU) tests to determine whether the placement of C. crispus with green plant mitochondria is significantly better supported than alternative arrangements.

  • Congruence Assessment: Compare cox3-based phylogenies with those derived from other mitochondrial and nuclear genes to identify potential gene-specific evolutionary patterns versus organism-level relationships.

This comprehensive approach has revealed the interesting evolutionary position of rhodophytes like C. crispus as potential intermediates in the evolution of plant mitochondria, exhibiting both plant-like phylogenetic affinity and non-plant mitochondrial characteristics .

What controls are essential when conducting functional assays with recombinant Chondrus crispus COX3?

When conducting functional assays with recombinant Chondrus crispus COX3, the following controls are essential to ensure valid and interpretable results:

  • Positive Controls:

    • Include well-characterized cytochrome c oxidase from model organisms (mouse or human) tested under identical conditions

    • Use purified native C. crispus mitochondrial preparations when available

    • Include other recombinant COX3 proteins with known activity profiles

  • Negative Controls:

    • Express and purify a catalytically inactive mutant (e.g., mutation in key catalytic residues)

    • Include mock-transfected/infected expression host preparations

    • Test activity in the presence of specific cytochrome c oxidase inhibitors

  • Validation Controls:

    • Verify glycosylation status by parallel expression with and without tunicamycin treatment

    • Confirm protein integrity through western blot analysis before functional testing

    • Perform activity assays across multiple substrate concentrations to generate complete kinetic profiles

  • System-Specific Controls:

    • Test activity at different temperatures relevant to C. crispus natural environment

    • Assess activity across a pH range to identify optimal conditions

    • Evaluate the effect of different detergents or membrane compositions

Implementing these controls helps distinguish between true functional properties of C. crispus COX3 and artifacts arising from the expression system or assay conditions, ensuring robust and reproducible results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.