Recombinant Chondrus crispus NADH-ubiquinone oxidoreductase chain 4L (ND4L)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Chondrus crispus NADH-Ubiquinone Oxidoreductase Chain 4L (ND4L)

Recombinant Chondrus crispus ND4L is a synthetic version of the mitochondrial Complex I subunit encoded by the ND4L gene. This hydrophobic protein (101 amino acids) is critical for electron transport in oxidative phosphorylation, facilitating the transfer of electrons from NADH to ubiquinone . Produced via recombinant DNA technology, it is typically expressed in E. coli or yeast systems, often with an N-terminal His-tag for purification .

Production and Purification

Expression Systems

Host OrganismExpression SystemPurityTagSource
E. coliBacterial>85%His
YeastEukaryotic>85%N/A

Functional Studies

  1. Complex I Assembly: Recombinant ND4L is used to study the minimal subunit requirements for Complex I activity. In Chlamydomonas, ND4L depletion abolishes the 950-kDa Complex I complex .

  2. Electron Transport: ND4L facilitates proton pumping during NADH-to-ubiquinone electron transfer, critical for ATP synthesis .

Diagnostic Tools

  • ELISA Kits: Detect ND4L in research samples, aiding in Complex I activity monitoring .

  • Structural Analysis: His-tagged ND4L enables crystallographic or cryo-EM studies to resolve Complex I’s transmembrane architecture .

Clinical and Biotechnological Relevance

Human vs. Chondrus crispus ND4L

AspectHuman ND4LChondrus crispus ND4L
Gene LocationMitochondrial DNANuclear genome (inferred from algae)
Disease AssociationLHON, metabolic disorders Basic research focus (no clinical data)
Research UseDisease modeling, drug developmentStructural biology, enzyme kinetics

Future Directions

  • Therapeutic Targets: Insights from Chondrus ND4L may inform strategies to modulate Complex I activity in mitochondrial diseases .

  • Industrial Applications: Potential use in bioenergy systems or bioremediation, leveraging redox properties .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ND4L; NAD4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Chondrus crispus (Carrageen Irish moss) (Polymorpha crispa)
Target Names
ND4L
Target Protein Sequence
MFQQLNCTNISSLLFLVSLLGIFLNQKNILVMLMSLEMMFLSISFNLIFSSIRLDDIIGQ IFSLLILTVAAAESSIGLAILVIYYRIRSTITVELMNLMKG
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly required for catalysis. Complex I plays a crucial role in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of NADH-ubiquinone oxidoreductase chain 4L (ND4L) in Chondrus crispus?

ND4L functions as a critical subunit of mitochondrial respiratory chain complex I in Chondrus crispus, participating in the electron transport chain essential for cellular respiration. This highly hydrophobic protein contributes to the structural integrity and enzymatic activity of complex I, which catalyzes the transfer of electrons from NADH to ubiquinone . Unlike some algal species like Chlamydomonadaceae that have transferred ND4L genes to the nucleus, Chondrus crispus maintains this gene in its mitochondrial genome, suggesting potential evolutionary significance in energy metabolism for this red seaweed . Research indicates that ND4L's specific transmembrane domains facilitate proton pumping across the inner mitochondrial membrane, directly contributing to ATP production efficiency in this intertidal species that must adapt to fluctuating environmental conditions .

How does the amino acid sequence of Chondrus crispus ND4L compare to other photosynthetic organisms?

The Chondrus crispus ND4L protein consists of 101 amino acids with a specific sequence: MFQQLNCTNISSLLFLLGIFNQKNILVMLMSLEMMFLSISFNLIFSSIRLDDIIGQIFSLLILTVAAAESSIGLAILVIYYRIRSTITVELMNLMKG . Comparative sequence analysis reveals several conserved hydrophobic domains consistent with its function as a membrane-embedded protein. Unlike some green algae that lack mitochondrially-encoded ND4L, Chondrus crispus maintains this gene in its mitochondrial genome, demonstrating an evolutionary divergence in organellar gene retention strategies . The protein contains characteristic transmembrane helices that contribute to the proton-pumping mechanism of complex I. Sequence alignment studies across red algae, green algae, and higher plants show highest conservation in the functional domains involved in ubiquinone interaction and electron transfer, while terminal regions exhibit greater variability, potentially reflecting adaptations to different ecological niches and metabolic requirements .

What are the structural characteristics of recombinant Chondrus crispus ND4L protein?

The recombinant Chondrus crispus ND4L protein exhibits distinct structural characteristics optimized for its membrane-bound function. The protein consists of 101 amino acids with multiple hydrophobic regions that form transmembrane helices, enabling proper integration into the inner mitochondrial membrane . Secondary structure prediction indicates the presence of three main α-helical transmembrane domains connected by short hydrophilic loops. When expressed as a recombinant protein, ND4L requires specific buffer conditions (typically Tris-based buffer with 50% glycerol) to maintain stability and prevent aggregation due to its highly hydrophobic nature . Structural analysis suggests that the N-terminal region contains a mitochondrial targeting sequence while the C-terminal domain participates in interactions with other complex I subunits. The protein's compact structure contributes to its role in the proton-pumping mechanism of complex I, with conserved charged residues strategically positioned to facilitate electron transport and proton translocation across the membrane .

What methodologies are most effective for expressing and purifying functional recombinant Chondrus crispus ND4L?

Expression and purification of functional recombinant Chondrus crispus ND4L presents significant challenges due to its hydrophobic nature and membrane-association properties. The most successful expression systems employ specialized E. coli strains (such as C41/C43 or Rosetta) harboring additional tRNAs for rare codons found in algal sequences . Expression protocols should incorporate low induction temperatures (16-18°C) and reduced IPTG concentrations (0.1-0.2 mM) to minimize inclusion body formation. For purification, a multi-step approach is recommended: initial extraction using mild detergents (n-dodecyl-β-D-maltoside or digitonin at 1-2%), followed by immobilized metal affinity chromatography with extended washing steps to remove contaminants while maintaining protein stability in detergent micelles . Size exclusion chromatography as a final polishing step significantly improves homogeneity. Throughout purification, maintaining the protein in a stabilizing buffer containing 50% glycerol and avoiding repeated freeze-thaw cycles is crucial for preserving functional integrity . Activity assays post-purification should employ artificial electron acceptors to verify that the recombinant protein maintains its native electron transport capacity. This methodological approach yields protein with approximately 85-90% purity suitable for structural and functional studies.

How can RNA interference techniques be optimized for studying ND4L function in Chondrus crispus?

Optimizing RNA interference (RNAi) for studying ND4L function in Chondrus crispus requires careful consideration of several technical parameters. Based on experimental approaches demonstrated with other algal species, construction of effective RNAi constructs should target unique regions of the ND4L transcript while avoiding sequences with similarity to other genes . For example, designing constructs similar to the pND4L-RNAi plasmid described in the literature, which contains inverted repeats of the target gene separated by a spacer intron, has proven effective . Transformation efficiency can be optimized using glass bead methods (for protoplasts) or biolistic approaches (for intact cells), with co-transformation using a selectable marker gene such as ARG7 to identify transformants . Verification of knockdown efficiency requires quantitative RT-PCR analysis targeting different regions of the ND4L transcript, with normalization to stable reference genes. Phenotypic analysis should include measurements of oxygen consumption rates, complex I activity assays, blue-native PAGE to assess complex assembly, and growth analysis under various carbon sources. Complementation experiments, where wild-type ND4L is re-expressed in knockdown lines, provide crucial controls to confirm phenotype specificity. This approach enables dissection of ND4L functional contributions to respiratory chain activity in this red algal species .

What are the comparative differences between mitochondrial and nuclear-encoded ND4L genes across algal species?

Comparative genomic analysis reveals fascinating evolutionary patterns in ND4L gene localization across algal lineages. While Chondrus crispus maintains ND4L as a mitochondrial gene, certain green algae including Chlamydomonadaceae have transferred this gene to the nuclear genome through evolutionary gene transfer events . This genomic relocation necessitates the acquisition of targeting sequences and codon optimization for cytosolic translation. Comparative sequence analysis of nuclear-encoded ND4L genes shows acquisition of N-terminal mitochondrial targeting peptides absent in mitochondrially-encoded homologs, typically 20-40 amino acids in length with characteristic features of alternating hydrophobic and positively charged residues . Expression regulation also differs significantly—mitochondrial ND4L transcription responds primarily to respiratory chain activity, while nuclear-encoded versions show coordinated regulation with nuclear-encoded complex I components and may respond to environmental signals like light intensity and nutrient availability. Protein import mechanisms for nuclear-encoded ND4L involve the TOM/TIM mitochondrial import machinery, requiring specific chaperones to prevent aggregation during transit. Functional studies comparing species with different genomic locations for ND4L indicate largely conserved functions within complex I despite evolutionary relocation, though nuclear control may permit more sophisticated regulatory mechanisms in response to environmental stimuli .

What are the key considerations for designing experiments to assess ND4L activity in complex I assembly?

When designing experiments to assess ND4L's role in complex I assembly, researchers should implement a multi-faceted approach combining genetic manipulation with biochemical and structural analyses. Begin by establishing appropriate controls, including wild-type samples and, ideally, complemented mutant lines to confirm phenotype specificity . Blue Native-PAGE (BN-PAGE) represents the gold standard methodology for evaluating complex I assembly, allowing visualization of both fully assembled complex I and subcomplexes that may accumulate in the absence of functional ND4L . This should be complemented by in-gel activity assays using NADH and nitrotetrazolium blue to assess functional integrity of assembled complexes.

For genetic manipulation, both knockdown (RNAi) and knockout approaches should be considered, with the latter achievable through CRISPR-Cas9 targeting of nuclear-encoded ND4L or, for mitochondrially-encoded variants, through established mitochondrial transformation protocols . Subcellular fractionation to isolate intact mitochondria is essential prior to biochemical analyses, with careful optimization of detergent concentrations (typically 1-2% digitonin or n-dodecyl-β-D-maltoside) to solubilize membrane complexes while preserving supercomplexes . Quantitative proteomic analysis of purified complexes can identify alterations in stoichiometry of other complex I subunits in response to ND4L manipulation. For analyzing respiratory function, oxygen consumption measurements using substrate-specific inhibitors (rotenone for complex I) provide critical functional data that complement the structural analyses .

How can researchers troubleshoot issues with recombinant ND4L protein aggregation during purification?

Protein aggregation represents a significant challenge when purifying recombinant ND4L due to its hydrophobic nature. A systematic troubleshooting approach begins with expression optimization—reducing induction temperature to 16-18°C and IPTG concentration to 0.1-0.2 mM can dramatically improve protein solubility by slowing synthesis and allowing proper membrane insertion . If aggregation persists, expression as a fusion protein with solubility-enhancing partners (MBP, SUMO, or TrxA) can significantly improve folding, though fusion partner removal may reintroduce aggregation challenges.

During extraction and purification, detergent selection is critical—initial screening of multiple detergents (DDM, digitonin, LDAO, and Triton X-100) at various concentrations (0.5-2%) should identify optimal solubilization conditions that maintain protein-lipid interactions . Buffer composition significantly impacts stability; inclusion of 50% glycerol as specified in protocols prevents aggregation by limiting protein-protein interactions, while addition of specific lipids (phosphatidylcholine or cardiolipin at 0.1-0.5 mg/ml) can mimic the native membrane environment . If aggregation occurs during concentration steps, increasing detergent concentration slightly above CMC or adding glycerol increments can preserve solubility.

For storage, maintaining the protein at -20°C in buffer containing 50% glycerol and avoiding repeated freeze-thaw cycles is essential, with working aliquots kept at 4°C for up to one week as recommended . Aggregation during functional assays can be minimized by performing reactions at protein concentrations below aggregation threshold and including stabilizing agents such as albumin (0.1-0.5 mg/ml) in reaction buffers.

What control experiments are essential when evaluating ND4L function through genetic manipulation?

Robust experimental design for evaluating ND4L function through genetic manipulation requires comprehensive controls to establish specificity and validate observed phenotypes. First, researchers must include wild-type parental strains as positive controls for all biochemical and physiological assays, maintaining identical growth and experimental conditions . For RNAi-based approaches, empty vector transformants serve as critical controls to distinguish specific ND4L knockdown effects from general transformation stress responses . Additionally, including RNAi constructs targeting unrelated genes of similar expression levels helps identify potential off-target effects mediated by the RNAi machinery.

Complementation experiments represent the gold standard control—reintroducing wild-type ND4L under a heterologous promoter in knockdown/knockout lines should rescue the observed phenotypes if they are specifically associated with ND4L depletion . For mitochondrial function studies, parallel analysis of other respiratory chain complexes (II-V) is essential to distinguish ND4L-specific effects from general mitochondrial dysfunction. When analyzing complex I assembly and function, dose-response experiments using varying levels of RNAi induction or with heteroplasmic mitochondrial mutants can reveal threshold effects and functional relationships.

Temporal controls are equally important—conducting analyses at multiple time points following induction of gene silencing helps distinguish primary effects from secondary adaptations . Finally, specificity controls at the molecular level should include qRT-PCR and Western blot analyses to confirm that only ND4L is affected while closely related genes and proteins maintain normal expression levels. This comprehensive control framework ensures that functional insights attributed to ND4L manipulation are specific and physiologically relevant.

How should researchers interpret complex I activity data in the context of ND4L manipulation?

Interpreting complex I activity data following ND4L manipulation requires careful consideration of multiple parameters and potential compensatory mechanisms. First, establish a standard curve of activity versus protein concentration to ensure measurements fall within the linear range of detection . When analyzing ND4L knockdown or knockout effects, correlate activity measurements with protein expression levels quantified by Western blot to establish dose-response relationships. Complex I-specific activity should be normalized to both total protein and to other respiratory chain complexes (particularly complex II, which serves as an internal control) to distinguish global effects from ND4L-specific impacts .

Activity data must be evaluated in the context of assembly state—partial complex I assembly may retain residual activity or exhibit altered substrate specificity. Blue Native-PAGE combined with in-gel activity assays enables correlation between assembled complex levels and enzymatic function . Kinetic parameters (Km and Vmax) for NADH oxidation should be determined, as ND4L manipulation may alter substrate affinity without affecting maximum capacity. Researchers should carefully distinguish electron transfer activity (NADH:ferricyanide reductase activity) from proton-pumping function (sensitive to inhibitors like rotenone), as these can be differentially affected by ND4L perturbation .

Statistical analysis should employ appropriate tests (typically ANOVA with post-hoc tests) comparing multiple independent biological replicates (n≥3) across different genotypes and conditions. Complementation experiments provide critical controls—partial restoration of activity in complemented lines suggests specific ND4L involvement, while failure to rescue may indicate irreversible assembly defects or additional mutations . Finally, interpretations should acknowledge the potential for compensatory upregulation of alternative electron transport pathways that may mask primary defects in long-term experiments.

What analytical approaches best characterize the structural integration of recombinant ND4L into complex I?

Characterizing the structural integration of recombinant ND4L into complex I requires multiple complementary analytical approaches that assess various aspects of protein-protein interaction and complex assembly. Crosslinking mass spectrometry (XL-MS) represents a powerful technique to map specific interaction sites between ND4L and neighboring subunits, utilizing reagents with different spacer lengths (DSS, EDC, or DSSO at 0.5-2 mM) followed by proteomic analysis to identify crosslinked peptides . This approach reveals direct protein contacts within the native complex environment.

Co-immunoprecipitation experiments using antibodies against either tagged recombinant ND4L or other complex I subunits can confirm physical association, while sequential immunoprecipitation (first capturing known complex I components, then ND4L) demonstrates incorporation into the fully assembled complex rather than peripheral association . Blue Native-PAGE combined with Western blotting or second-dimension SDS-PAGE provides visual confirmation of ND4L integration into complex I and reveals potential subcomplexes formed during assembly.

How can researchers effectively analyze evolutionary patterns of ND4L gene transfer between mitochondrial and nuclear genomes?

Analyzing evolutionary patterns of ND4L gene transfer between mitochondrial and nuclear genomes requires a multifaceted approach combining computational phylogenetics with experimental validation. Researchers should begin by assembling a comprehensive dataset of ND4L sequences from diverse algal and plant lineages, including representatives from all major clades, with particular attention to taxa like Chlamydomonadaceae that demonstrate nuclear relocation versus species like Chondrus crispus that maintain mitochondrial ND4L genes . Genome mining should utilize both sequence similarity searches and profile hidden Markov models to identify divergent homologs that might escape detection by standard BLAST approaches.

Phylogenetic analysis using maximum likelihood or Bayesian methods with appropriate evolutionary models (typically LG+G+F for mitochondrial membrane proteins) can reconstruct the evolutionary history of gene transfers . Transfer events are identifiable as topological incongruencies between ND4L gene trees and established organismal phylogenies. For each identified nuclear-encoded ND4L, detailed sequence analysis should examine acquisition of mitochondrial targeting sequences, alterations in codon usage patterns reflecting nuclear versus mitochondrial preferences, and changes in selection pressure (dN/dS ratios) following relocation .

Experimental approaches complement computational analyses—RNA-seq data can confirm expression of nuclear copies while mitochondrial genome sequencing verifies absence of mitochondrial versions. For functional validation, heterologous expression of nuclear-encoded ND4L with and without targeting sequences in model systems can verify mitochondrial import capability . Ancestral sequence reconstruction techniques allow modeling of evolutionary intermediates during the transfer process. This integrated approach reveals not just when transfers occurred but also the molecular mechanisms facilitating successful gene relocation while maintaining essential respiratory functions.

What emerging technologies could advance our understanding of ND4L function in Chondrus crispus?

Several cutting-edge technologies hold promise for deepening our understanding of ND4L function in Chondrus crispus. CRISPR-Cas9 mitochondrial genome editing, recently demonstrated in some algal systems, could enable precise mutation of specific ND4L domains to establish structure-function relationships without complete gene disruption . Developments in cryogenic electron microscopy (cryo-EM) now permit resolution of membrane protein structures at near-atomic detail, potentially revealing how ND4L contributes to proton translocation and complex I assembly in this red algal system.

Single-molecule tracking using photoactivatable fluorescent proteins fused to ND4L could visualize its dynamic behavior during complex assembly in living cells. This approach, combined with super-resolution microscopy techniques like STORM or PALM, would provide unprecedented insights into mitochondrial respiratory complex formation . Microfluidic-based approaches for high-throughput phenotyping of ND4L variants could rapidly screen hundreds of mutations for functional impacts on growth, stress tolerance, and respiratory capacity.

Advanced metabolomic profiling using stable isotope labeling combined with mass spectrometry could reveal how ND4L alterations affect metabolic flux through central carbon metabolism pathways. Ribosome profiling of mitochondrial translation would provide novel insights into the synthesis regulation of ND4L relative to other mitochondrially-encoded subunits . Additionally, emerging protein-protein interaction mapping technologies like proximity labeling (BioID or APEX) could comprehensively identify the interaction network surrounding ND4L during various assembly stages and environmental conditions . Together, these technologies promise to transform our understanding of this critical respiratory chain component in Chondrus crispus.

How might comparative studies between Chondrus crispus and other algal species advance our understanding of respiratory chain evolution?

Comparative studies between Chondrus crispus and other algal species represent a powerful approach to unraveling respiratory chain evolution across photosynthetic lineages. Strategic selection of comparison species should include representatives with nuclear-encoded ND4L (like Chlamydomonadaceae) alongside those with mitochondrially-encoded versions, spanning diverse phylogenetic positions . This comparative framework enables identification of selective pressures driving gene retention in mitochondrial versus nuclear genomes across evolutionary timescales.

Functional comparison of complex I assembly pathways between species with different ND4L genomic locations could reveal how transfer to the nucleus impacts assembly mechanisms, potentially through acquisition of auxiliary factors that facilitate import and membrane insertion . Detailed mapping of protein-protein interactions within complex I across multiple species would identify conserved versus lineage-specific interaction interfaces involving ND4L, illuminating structural adaptations following genomic relocation.

Transcriptional and translational regulation analysis comparing nuclear versus mitochondrially-encoded ND4L genes could reveal how regulatory control mechanisms evolve following gene transfer events . Evolutionary rate comparisons would determine whether nuclear relocation accelerates or constrains sequence evolution. Experimental approaches could include heterologous complementation experiments, where ND4L from one species is expressed in mutants of another, testing functional interchangeability despite evolutionary divergence.

Environmental adaptation studies comparing respiratory responses across species from different habitats would reveal how ND4L modifications contribute to respiratory efficiency under varying conditions—particularly relevant for intertidal species like Chondrus crispus that experience fluctuating oxygen availability . Together, these comparative approaches would illuminate both the mechanisms and selective advantages driving respiratory chain evolution across the algal lineage.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.