Recombinant Chondrus crispus Succinate dehydrogenase cytochrome b560 subunit (SDH3)

Shipped with Ice Packs
In Stock

Description

Introduction

Succinate dehydrogenase cytochrome b560 subunit (SDH3) is a vital component of the succinate dehydrogenase (SDH) complex, also known as respiratory complex II. This complex participates in both the citric acid cycle and the electron transport chain in mitochondria . SDH3 functions as a cytochrome b subunit of succinate dehydrogenase, which is crucial for coupling the oxidation of succinate to the transfer of electrons to ubiquinone .

Structure and Function

The SDH3 protein contains multiple potential transmembrane domains . Specifically, in Saccharomyces cerevisiae, SDH3 contains three potential transmembrane domains and shares over 30% sequence identity with bovine cytochrome b560 and a mitochondrially encoded protein from Marchantia polymorpha . Together with SDH4, SDH3 anchors the catalytic dimer, which is formed by SDH1 and SDH2, to the mitochondrial inner membrane .

In Saccharomyces cerevisiae, SDH3 is a 198 amino acid protein . SDH3, along with SDH1, SDH2, and SDH4, is essential for the oxidation of succinate and the transfer of electrons to ubiquinone as part of the TCA cycle and the mitochondrial respiratory chain .

Role in Cellular Processes

SDH3 is involved in several key cellular processes:

  • Cellular Respiration SDH3 is essential for growth on non-fermentable carbon sources, indicating its critical role in cellular respiration .

  • Protein Insertion into Mitochondrial Inner Membrane SDH3 participates in protein insertion into the mitochondrial inner membrane . It is required for mitochondrial inner membrane protein import as part of the TIM22 complex .

  • TCA Cycle and Mitochondrial Respiratory Chain SDH3 couples the oxidation of succinate to the transfer of electrons to ubiquinone within the TCA cycle and the mitochondrial respiratory chain .

SDH3 in Different Organisms

SDH3 is found in various organisms, including yeast (Saccharomyces cerevisiae), plants (Arabidopsis thaliana), and red algae (Chondrus crispus) . The protein's function is generally conserved across species, although specific details may vary.

Interactions and Regulation

SDH3 interacts with several proteins to perform its functions:

  • SDH1, SDH2, and SDH4 These are other subunits of the succinate dehydrogenase complex. SDH3 works with these subunits to facilitate succinate oxidation and electron transfer .

  • TIM18, TIM54, and TIM12 SDH3 interacts with these proteins as part of the TIM22 complex, which is involved in the insertion of polytopic proteins into the mitochondrial inner membrane .

  • SHH4 SHH4 is a paralog of SDH4 and can function as a functional SDH subunit. It interacts with SDH3 and has greater similarity to human SDHD .

Expression of SDH3, along with SDH1 and SDH4, is activated in the presence of the HAP2 transcriptional activator .

Disease Associations and Resistance

Mutations in succinate dehydrogenase subunits, including SDH3, have been linked to various diseases. For example, mutations in human ortholog SDHA are associated with Leigh syndrome . SDH3 is also implicated in resistance to certain fungicides. A mutation in the cytochrome b560 subunit of succinate dehydrogenase complex (Complex II) confers resistance to flutolanil and carboxin in Coprinus cinereus .

Recombinant SDH3

Recombinant SDH3 is produced using in vitro E. coli expression systems . It can be purchased for research purposes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SDH3; SDHC; Succinate dehydrogenase cytochrome b560 subunit; Succinate dehydrogenase, subunit III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Chondrus crispus (Carrageen Irish moss) (Polymorpha crispa)
Target Names
SDH3
Target Protein Sequence
MFIKFKISNRPIAPHLLVYTPQLSSLFSIWHRISGVGLAFFFTTFLIFIRIILSSNFACN LLTLISFEISQWIIIYFNLFILLFLFYHLFNGTRHIIWDFGFLLDIKYLSKFSLFLLVSL SLILIFQ
Uniprot No.

Target Background

Function
Membrane-anchoring subunit of succinate dehydrogenase (SDH), a component of mitochondrial complex II in the electron transport chain. It facilitates electron transfer from succinate to ubiquinone (coenzyme Q).
Database Links
Protein Families
Cytochrome b560 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does Chondrus crispus SDH3 compare to SDH3 proteins from other species?

While the specific sequence homology analysis is not provided in the available search results, SDH3 proteins are generally conserved across species due to their essential role in energy metabolism. Chondrus crispus, as a red seaweed (Rhodophyta), represents an interesting evolutionary branch for studying the conservation of mitochondrial respiratory complexes .

Comparative studies would typically analyze:

  • Sequence alignment showing conserved functional domains

  • Structural prediction models highlighting membrane-spanning regions

  • Conservation of critical amino acid residues involved in ubiquinone binding

The UniProt accession P48934 for this protein allows researchers to perform detailed comparative analyses with SDH3 homologs from other species to identify conserved regions that may be critical for protein function .

What is the biochemical function of SDH3 in mitochondrial metabolism?

SDH3 serves as a membrane anchor for the succinate dehydrogenase complex (Complex II) of the respiratory chain. Functionally, it:

  • Forms part of the membrane-bound portion of the enzyme complex alongside another subunit (likely SDH4)

  • Contains the binding site for ubiquinone, facilitating electron transfer from the water-soluble catalytic dimer to the electron transport chain

  • Contributes to the structural integrity of the SDH complex in the inner mitochondrial membrane

  • Participates in the conversion of succinate to fumarate in the TCA cycle while reducing ubiquinone to ubiquinol

Recent research has demonstrated that beyond its role in energy metabolism, SDH activity significantly impacts de novo purine synthesis pathways, making it a critical junction between mitochondrial metabolism and nucleotide biosynthesis .

How does SDH inhibition specifically affect purine biosynthesis pathways?

Recent findings demonstrate a critical relationship between SDH activity and de novo purine synthesis. When SDH is inhibited either genetically or pharmacologically:

  • Purine synthesis is markedly attenuated, leading to significant reduction in cell proliferation

  • Succinate accumulates intracellularly to levels that directly impair purine biosynthetic pathway enzymes

  • Cancer cells often respond by upregulating the purine salvage pathway as a compensatory mechanism

This metabolic crosslink represents a significant area for cancer research, as the dual inhibition of SDH and the purine salvage pathway has demonstrated pronounced antiproliferative and antitumoral effects in preclinical models . The mechanism appears to involve succinate-mediated signaling that regulates nucleotide metabolism, revealing a previously underappreciated role for this TCA cycle intermediate.

What experimental approaches are most effective for studying the functional properties of recombinant Chondrus crispus SDH3?

For comprehensive functional characterization of recombinant Chondrus crispus SDH3, researchers should consider these methodological approaches:

Biochemical Assays:

  • Measure SDH enzyme activity using spectrophotometric methods that track the reduction of artificial electron acceptors

  • Assess membrane incorporation efficiency using reconstitution in liposomes

  • Determine ubiquinone binding kinetics using isothermal titration calorimetry

Structural Analysis:

  • Cryo-electron microscopy of the reconstituted complex

  • Protein crystallography (challenging for membrane proteins but possible with advanced techniques)

  • Circular dichroism to assess secondary structure elements

Functional Studies:

  • Complementation assays in SDH3-deficient systems

  • Site-directed mutagenesis of predicted functional residues

  • Protein-protein interaction studies to assess assembly with other SDH subunits

The recombinant protein should be stored at -20°C or -80°C for extended storage, with working aliquots maintained at 4°C for up to one week to preserve activity. Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity .

How can researchers address the challenges of working with a hydrophobic membrane protein like SDH3?

Working with hydrophobic membrane proteins like SDH3 presents several technical challenges that require specialized approaches:

Solubilization Strategies:

  • Use of appropriate detergents (CHAPS, DDM, or digitonin) at concentrations above their critical micelle concentration

  • Application of amphipols or nanodiscs for maintaining native-like environments

  • Careful optimization of buffer conditions (pH, ionic strength) to prevent aggregation

Expression Systems:

  • Selection of expression systems capable of proper membrane protein folding and post-translational modifications

  • Consideration of Chondrus crispus codon usage when designing expression constructs

  • Potential use of fusion tags that enhance solubility while maintaining function

Purification Considerations:

  • Two-phase extraction methods for initial enrichment

  • Affinity chromatography using properly positioned tags

  • Size exclusion chromatography in the presence of appropriate detergents

The storage buffer for recombinant Chondrus crispus SDH3 typically includes 50% glycerol and a Tris-based buffer formulation optimized for protein stability . This high glycerol concentration helps prevent protein aggregation and maintains the native conformation of the membrane protein during storage.

What are the optimal conditions for expression and purification of functional recombinant Chondrus crispus SDH3?

The optimization of expression and purification conditions for Chondrus crispus SDH3 requires careful consideration of the following factors:

Expression System Selection:

  • Bacterial systems (E. coli) with specialized strains for membrane protein expression

  • Yeast systems (P. pastoris) for eukaryotic post-translational modifications

  • Insect cell systems for complex eukaryotic membrane proteins

Induction Parameters:

  • Temperature (typically lower temperatures of 16-20°C favor proper folding)

  • Inducer concentration optimization

  • Duration of expression (extended periods at lower temperatures)

Purification Protocol:

  • Cell lysis using methods that effectively solubilize membranes

  • Membrane fraction isolation via differential centrifugation

  • Detergent solubilization using a screening approach to identify optimal detergent

  • Affinity chromatography using appropriate tags

  • Size exclusion chromatography for final purification

Quality Control Measures:

  • SDS-PAGE analysis for purity assessment

  • Western blotting for identity confirmation

  • Circular dichroism to verify proper folding

  • Activity assays to confirm functional state

The recombinant protein is typically stored in a specialized buffer containing 50% glycerol and Tris buffer optimized for this specific protein . This formulation helps maintain stability during storage at -20°C or -80°C for extended periods.

How can researchers effectively reconstitute SDH3 into functional complexes for activity studies?

Reconstitution of SDH3 into functional complexes requires systematic approaches to ensure proper assembly and activity:

Component Preparation:

  • Purification of all four SDH subunits (SDH1, SDH2, SDH3, SDH4) with appropriate tags

  • Verification of each subunit's individual integrity before reconstitution attempts

  • Preparation of lipid mixtures that mimic the native mitochondrial inner membrane

Reconstitution Methods:

  • Detergent-mediated reconstitution:

    • Mixing of purified components in appropriate ratios

    • Controlled detergent removal via dialysis or bio-beads

    • Verification of complex formation by size exclusion chromatography

  • Liposome incorporation:

    • Formation of liposomes with mitochondrial lipid composition

    • Incorporation of complete complex or sequential addition of components

    • Confirmation of orientation using protease protection assays

  • Nanodiscs approach:

    • Assembly using membrane scaffold proteins

    • Size-controlled environment for single complex studies

    • Amenability to structural and functional studies

Activity Verification:

  • Succinate:ubiquinone oxidoreductase activity measurements

  • EPR spectroscopy to confirm proper heme integration

  • Membrane potential generation in proteoliposomes

This methodological approach enables the study of both the membrane-anchoring role of SDH3 and its contribution to the catalytic function of the complete SDH complex.

What techniques are most effective for studying SDH3 interactions with other components of the respiratory chain?

Several complementary techniques provide insights into SDH3 interactions with other respiratory complex components:

Biochemical Approaches:

TechniqueApplicationResolutionLimitations
Blue Native PAGEIsolation of intact respiratory supercomplexesComplex integrityLimited structural detail
Chemical crosslinkingIdentification of direct protein-protein contactsAmino acid levelPotential artifacts
Co-immunoprecipitationVerification of specific interactionsComplex levelRequires specific antibodies
Proximity labeling (BioID)Identification of transient interactionsProtein levelRequires genetic modification

Biophysical Methods:

  • Förster Resonance Energy Transfer (FRET) for measuring intermolecular distances

  • Surface Plasmon Resonance (SPR) for binding kinetics determination

  • Hydrogen-Deuterium Exchange Mass Spectrometry for mapping interaction interfaces

Structural Approaches:

  • Cryo-electron microscopy of respiratory supercomplexes

  • X-ray crystallography of defined subcomplexes

  • Molecular dynamics simulations to model dynamic interactions

Functional Assessment:

  • Respiration measurements in reconstituted systems

  • Electron transfer kinetics between complexes

  • ROS production measurements at complex interfaces

Understanding these interactions is crucial as SDH (Complex II) has been shown to participate in supercomplex formation with other respiratory chain components, influencing both efficiency of electron transfer and regulation of mitochondrial metabolism .

How can Chondrus crispus SDH3 research contribute to understanding mitochondrial disorders?

Research on Chondrus crispus SDH3 can provide significant insights into mitochondrial disorders through several avenues:

Evolutionary Conservation Studies:

  • Analysis of conserved functional domains across species can highlight critical residues

  • Identification of species-specific adaptations may reveal functional flexibility

  • Understanding of evolutionary constraints can inform the interpretation of human mutations

Structure-Function Relationships:

  • Detailed characterization of the algal protein can inform understanding of human SDH3

  • Mutations that affect function in Chondrus crispus may correspond to pathogenic variants in humans

  • Alternative splicing or regulatory mechanisms may be conserved across evolutionary distance

Disease Mechanism Insights:

  • SDH mutations in humans are associated with paragangliomas, pheochromocytomas, and other tumors

  • The mechanism linking SDH dysfunction to purine synthesis impairment may explain growth defects in patients

  • Understanding how succinate accumulation affects cellular processes can clarify disease pathophysiology

Therapeutic Development:

  • Identification of critical functional domains may guide drug design

  • Screening platforms using recombinant proteins can identify potential therapeutic compounds

  • Understanding of compensatory mechanisms may reveal potential therapeutic targets

The connection between SDH activity and purine synthesis discovered in recent research has particularly important implications for understanding the growth defects observed in patients with SDH mutations, suggesting a metabolic basis for these clinical presentations .

What implications does the relationship between SDH and purine synthesis have for cancer research?

The recently discovered relationship between SDH activity and de novo purine synthesis has significant implications for cancer research:

Metabolic Vulnerabilities:

  • Cancer cells often exhibit increased dependence on nucleotide synthesis for rapid proliferation

  • SDH inhibition creates a metabolic bottleneck by reducing purine synthesis capacity

  • Cancer cells respond by upregulating the purine salvage pathway, creating a potential therapeutic vulnerability

Therapeutic Strategies:

  • Dual targeting of SDH and purine salvage pathways shows enhanced antitumoral effects

  • Pharmacological agents that exploit this metabolic dependency could be developed

  • Biomarkers based on SDH activity could predict response to such targeted approaches

Oncogenic Mechanisms:

  • SDH mutations in certain cancers may drive tumorigenesis partly through altered nucleotide metabolism

  • Succinate accumulation serves as both a metabolic block and a signaling molecule

  • This metabolic reprogramming may contribute to the cancer phenotype beyond just energy metabolism

Clinical Applications:

  • Diagnostic approaches measuring SDH activity or succinate levels

  • Prognostic indicators based on purine synthesis pathway activity

  • Personalized treatment selection based on metabolic profiling

This research highlights a previously underappreciated metabolic vulnerability that could be exploited therapeutically, with co-inhibition of SDH and purine salvage pathways showing particular promise in preclinical models .

How can comparative studies of SDH3 across species inform our understanding of mitochondrial evolution?

Comparative studies of SDH3 across diverse species including Chondrus crispus provide valuable insights into mitochondrial evolution:

Evolutionary Trajectory Analysis:

  • Red algae like Chondrus crispus represent an important evolutionary branch in eukaryotic lineage

  • Sequence and structural conservation can reveal fundamental functional requirements maintained across billions of years

  • Lineage-specific adaptations may indicate environmental pressures shaping mitochondrial function

Functional Adaptation Mechanisms:

  • Comparison of SDH3 from organisms in different thermal environments can reveal temperature adaptation strategies

  • Chondrus crispus, which grows in variable marine environments, may exhibit specialized adaptations

  • These adaptations could inform understanding of how mitochondrial function adapts to environmental conditions

Endosymbiotic Theory Insights:

  • SDH represents a evolutionary connection point between the TCA cycle and electron transport chain

  • Comparative analysis can reveal how these systems became integrated during mitochondrial evolution

  • Conservation patterns may indicate the sequence of evolutionary events in mitochondrial development

Horizontal Gene Transfer Assessment:

  • Analysis can identify potential instances of horizontal gene transfer in mitochondrial genes

  • This would contribute to understanding the complex evolutionary history of mitochondria

  • Such events might explain unexpected similarities between distantly related species

The physiological adaptations of Chondrus crispus to variable marine environments, including temperature fluctuations, may be reflected in specific adaptations of its mitochondrial enzymes like SDH3 . Understanding these adaptations provides insight into both the evolutionary processes and the functional plasticity of mitochondrial respiratory complexes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.