Recombinant Choristoneura occidentalis Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Choristoneura occidentalis Cytochrome c Oxidase Subunit 2 (COII)

Recombinant Choristoneura occidentalis Cytochrome c oxidase subunit 2 (COII) is a genetically engineered protein derived from the western spruce budworm, Choristoneura occidentalis. This protein is part of the cytochrome c oxidase complex, which plays a crucial role in the electron transport chain of mitochondria, facilitating the transfer of electrons and contributing to the production of ATP, the primary energy currency of cells.

Function and Importance of Cytochrome c Oxidase Subunit 2

Cytochrome c oxidase is the terminal enzyme in the mitochondrial electron transport chain, responsible for transferring electrons from cytochrome c to oxygen, which is then reduced to water. Subunit 2 (COII) is one of the core subunits of this enzyme and is encoded by the mitochondrial genome in most organisms. In recombinant forms, COII can be expressed in various hosts to study its function, structure, and potential applications in biotechnology and medicine.

Recombinant Expression and Applications

Recombinant expression of COII involves inserting the gene encoding this protein into a suitable vector, which is then introduced into a host organism such as bacteria or yeast. This allows for large-scale production of the protein for research and potential therapeutic uses. Recombinant COII can be used to study mitochondrial function, understand the mechanisms of electron transport, and develop diagnostic tools or treatments related to mitochondrial disorders.

Challenges and Future Directions

One of the challenges in working with recombinant COII is ensuring proper folding and integration into the mitochondrial membrane, as these proteins are often hydrophobic and require specific conditions for correct assembly. Future research should focus on optimizing expression systems and exploring novel applications in biotechnology and medicine.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and approved in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Choristoneura occidentalis (Western spruce budworm)
Target Names
COII
Target Protein Sequence
MATWSNFNLQNSASPLMEQIIFFHDHTLVILIMITILVGYLMISLFFNSYINRFLLEGQM IELIWTILPAITLIFIALPSLRLLYLLDELNNPLITLKSIGHQWYWSYEYSDFQNIQFDS YMIPINEMKNNNFRLLDVDNRIVLPMNNQIRILVTATDVIHSWTIPSLGVKVDANPGRLN QTNFFINRPGIFYGQCSEICGANHSFMPIVIESISIKNFINWINNYS
Uniprot No.

Target Background

Function

Recombinant Choristoneura occidentalis Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (CIV). These complexes collaborate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthase and transmembrane transport. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred through the CuA center of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) composed of heme A3 and CuB. The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Choristoneura occidentalis and why is its COII protein significant for research?

Choristoneura occidentalis, commonly known as the western spruce budworm, is a lepidopteran forest pest that has been the subject of extensive ecological and molecular research. The COII protein is significant because:

  • It functions as a critical component of the mitochondrial respiratory chain

  • It serves as an important molecular marker for phylogenetic studies and population genetics

  • It provides insights into metabolic adaptations of forest insects

  • It represents a conserved mitochondrial protein that can be compared across related species

The recombinant form enables researchers to study its structure and function in controlled laboratory conditions without extracting it directly from insect specimens, which is particularly valuable given the seasonal availability and conservation concerns associated with wild collection .

How is recombinant Choristoneura occidentalis COII protein produced and purified?

The production process involves several standardized steps:

  • The COII gene sequence is cloned into an expression vector with an N-terminal His-tag

  • The construct is transformed into E. coli as the expression host

  • Bacterial cultures are grown under controlled conditions to express the protein

  • The protein is purified using affinity chromatography targeting the His-tag

  • Purity is verified through SDS-PAGE analysis (>90% purity)

  • The purified protein is formulated in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • The final preparation is lyophilized for stability and storage

This bacterial expression system provides a reliable and scalable method for producing consistent batches of the recombinant protein for research applications .

How does Choristoneura occidentalis COII compare with COII from related species?

Comparative analysis between C. occidentalis COII and C. rosaceana (oblique banded leafroller) COII reveals important evolutionary insights:

The high sequence similarity suggests conserved respiratory chain function, while the few amino acid differences may reflect subtle adaptations to different ecological niches. C. occidentalis primarily affects coniferous hosts while C. rosaceana has a broader host range including deciduous plants .

What are the optimal storage and handling conditions for the recombinant protein?

For maximum stability and activity, the following storage protocols are recommended:

  • Store lyophilized powder at -20°C/-80°C

  • For reconstitution:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water (0.1-1.0 mg/mL)

    • Add glycerol to 5-50% final concentration (50% is recommended)

    • Prepare small aliquots to minimize freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage, maintain at -20°C/-80°C with aliquoting to prevent freeze-thaw damage

  • Avoid repeated freezing and thawing as this significantly reduces protein stability and activity

What experimental approaches are optimal for studying COII function in vitro?

For functional characterization of recombinant C. occidentalis COII, several methodological approaches are recommended:

  • Enzymatic activity assays:

    • Polarographic oxygen consumption measurements

    • Spectrophotometric monitoring of electron transfer rates

    • Coupled enzyme assays with other respiratory chain components

  • Structural characterization:

    • Circular dichroism spectroscopy for secondary structure analysis

    • Limited proteolysis to identify domain boundaries

    • Thermal shift assays to assess stability under various conditions

  • Membrane incorporation studies:

    • Reconstitution into liposomes of defined composition

    • Proteoliposome-based functional assays

    • Membrane potential measurements using fluorescent probes

When designing these experiments, researchers should consider potential effects of the His-tag on protein function and include appropriate controls such as tag-cleaved preparations .

How can researchers address potential artifacts from the His-tag in experimental systems?

The His-tag used for purification may introduce experimental artifacts that should be systematically addressed:

  • Tag interference assessment:

    • Compare activity parameters of tagged versus native protein

    • Perform structural analyses to detect potential conformational changes

    • Test metal chelation effects using EDTA controls

  • Tag removal strategies:

    • Incorporate TEV or thrombin protease cleavage sites between tag and protein

    • Optimize digestion conditions for complete tag removal

    • Verify removal by mass spectrometry or SDS-PAGE

  • Control experiments:

    • Include tagged control proteins with known function

    • Perform concentration-dependent experiments to distinguish specific interactions

    • Test multiple tag positions if functional interference is observed

These approaches help ensure that experimental observations reflect the intrinsic properties of C. occidentalis COII rather than tag-induced artifacts .

What are the challenges in comparative evolutionary studies using recombinant COII?

When using recombinant C. occidentalis COII for evolutionary analyses, several methodological considerations are important:

  • Sequence verification:

    • Confirm recombinant sequence matches wild-type reference sequences

    • Check for potential cloning artifacts or expression-induced mutations

    • Consider natural polymorphisms that may exist in wild populations

  • Phylogenetic analysis framework:

    • Select appropriate evolutionary models that account for mitochondrial gene characteristics

    • Implement codon-based partitioning schemes

    • Test for selection using dN/dS analyses across functional domains

  • Functional divergence testing:

    • Design experiments to test functional consequences of species-specific substitutions

    • Use site-directed mutagenesis to create variants matching related species

    • Correlate sequence differences with ecological or physiological traits

When analyzing cypovirus associations with Choristoneura species, researchers should note that C. occidentalis has been associated with a species type-16 cypovirus (CoCPV) that is related to cypoviruses isolated from C. fumiferana .

How can recombinant COII be used in molecular ecology and pest management research?

The recombinant protein and its encoding gene have valuable applications in ecological and management contexts:

  • Population structure analysis:

    • COII sequences serve as effective markers for distinguishing isolated populations

    • Haplotype diversity can reveal historical population dynamics

    • Comparison with nuclear markers can identify sex-biased dispersal patterns

  • Adaptation research:

    • Investigation of COII variants across environmental gradients

    • Functional testing of variants under different temperature regimes

    • Correlation of specific substitutions with ecological factors

  • Biocontrol applications:

    • Development of molecular tools for rapid identification of pest species

    • Tracking of population movements and introductions

    • Assessment of genetic diversity before implementing control measures

These applications demonstrate how fundamental research on mitochondrial proteins contributes to both evolutionary understanding and practical management of forest pest species .

What are the best practices for experimental design when comparing COII from different Choristoneura species?

When conducting comparative studies of COII across Choristoneura species, researchers should implement these methodological best practices:

  • Sample preparation consistency:

    • Use identical expression systems and purification protocols

    • Prepare proteins under identical buffer conditions

    • Verify comparable purity levels through SDS-PAGE

  • Functional comparison approaches:

    • Employ standardized activity assays under identical conditions

    • Test function across a range of temperatures relevant to species ecology

    • Include appropriate positive and negative controls

  • Data analysis considerations:

    • Use statistical methods that account for technical variability

    • Implement multiple testing correction for high-throughput comparisons

    • Correlate molecular differences with ecological or physiological traits

  • Integrated analysis:

    • Combine sequence data, structural predictions, and functional assays

    • Consider the evolutionary context of observed differences

    • Relate findings to ecological differences between species

These approaches enable robust comparative analysis while minimizing technical artifacts that could confound biological interpretation .

What quality control methods are essential for recombinant COII research?

To ensure experimental reproducibility and reliable results, several quality control measures should be implemented:

  • Protein integrity verification:

    • SDS-PAGE analysis to confirm size and purity (>90% purity standard)

    • Mass spectrometry to verify intact mass and sequence coverage

    • Western blotting with anti-His antibodies to confirm tag presence

  • Functional verification:

    • Activity assays to confirm protein is properly folded

    • Thermal stability analysis to assess conformational integrity

    • Spectroscopic methods to verify secondary structure elements

  • Storage stability monitoring:

    • Periodic testing of stored aliquots to detect potential degradation

    • Comparison of fresh versus stored preparations

    • Implementation of quality control thresholds for experimental use

Researchers should document these quality control measures in publications to enable proper replication and interpretation of results .

How can researchers optimize reconstitution protocols for experimental applications?

The lyophilized recombinant protein requires careful reconstitution to maintain activity:

  • Pre-reconstitution preparation:

    • Equilibrate the lyophilized protein to room temperature before opening

    • Briefly centrifuge to collect material at the bottom of the vial

  • Reconstitution procedure:

    • Add deionized sterile water to achieve 0.1-1.0 mg/mL concentration

    • Gently mix without vortexing to avoid protein denaturation

    • Allow complete dissolution before proceeding

  • Stabilization approaches:

    • Add glycerol to 50% final concentration for cryoprotection

    • Aliquot immediately to minimize freeze-thaw cycles

    • For specific applications, test alternative buffer compositions

  • Application-specific considerations:

    • For enzymatic assays, verify activity immediately after reconstitution

    • For structural studies, filter the reconstituted protein to remove aggregates

    • For long-term experiments, prepare fresh reconstitutions regularly

Following these protocols helps maintain protein integrity and experimental consistency across multiple preparations .

What bioinformatic tools are most valuable for analyzing Choristoneura COII sequences?

Several computational approaches facilitate analysis of COII sequences from Choristoneura species:

  • Sequence analysis tools:

    • Multiple sequence alignment programs (MUSCLE, MAFFT) for comparative analysis

    • MEGA X for phylogenetic reconstruction and evolutionary rate calculation

    • DnaSP for population genetic analyses of nucleotide polymorphism

  • Structural prediction methods:

    • SWISS-MODEL for homology modeling based on related cytochrome oxidase structures

    • TMHMM for transmembrane domain prediction

    • ConSurf for mapping evolutionary conservation onto structural models

  • Functional prediction approaches:

    • InterProScan for functional domain identification

    • PROVEAN for assessing the functional impact of amino acid substitutions

    • Selecton for detecting positive selection at specific codons

These computational resources complement experimental approaches and provide context for interpreting observed sequence variations .

How does cypovirus infection affect COII expression in Choristoneura occidentalis?

The interaction between cypoviruses and mitochondrial gene expression in C. occidentalis is an emerging research area:

  • CoCPV (Choristoneura occidentalis Cypovirus) has been isolated from wild populations and characterized at the molecular level

  • The virus contains 10 genomic segments (S1-S10) with conserved terminal motifs

  • While direct effects on COII expression have not been fully characterized, viral infection can broadly impact host metabolism

  • Research on related cypoviruses suggests potential modulation of mitochondrial function during infection

Studying the recombinant COII protein in conjunction with viral infection models could provide insights into host-pathogen interactions and potential applications for biological control strategies .

What are the critical differences in experimental approaches when working with recombinant versus native COII?

Researchers should consider several key differences when deciding between recombinant and native protein approaches:

ParameterRecombinant COIINative COIIExperimental Implications
SourceE. coli expressionDirect insect extractionRecombinant offers consistent supply, independent of seasonal availability
Purity>90% via affinity chromatographyVariable, multiple purification stepsRecombinant provides higher reproducibility for quantitative assays
ModificationsHis-tag present, bacterial PTMsNatural PTMs, no artificial tagsNative better represents in vivo state with authentic modifications
Complex formationIsolated subunitPart of complete COX complexNative better for studying intersubunit interactions
ScalabilityHighly scalableLimited by insect availabilityRecombinant advantageous for high-throughput applications
CostLower cost per mgHigher extraction costsBudget considerations for extensive experimental series

Understanding these trade-offs helps researchers select the most appropriate approach based on their specific experimental questions and available resources .

What emerging technologies might enhance Choristoneura occidentalis COII research?

Several cutting-edge approaches are poised to advance research on this protein:

  • Cryo-electron microscopy:

    • Single-particle analysis of COII in membrane environments

    • Structural determination at near-atomic resolution

    • Visualization of conformational changes during catalytic cycle

  • CRISPR-based technologies:

    • Genome editing of native COII in Choristoneura species

    • Development of reporter systems for in vivo localization

    • Creation of isogenic lines with specific COII variants

  • Single-molecule techniques:

    • FRET measurements to track conformational dynamics

    • Optical tweezers to study mechanistic properties

    • Nanopore analysis for protein-substrate interactions

  • Computational approaches:

    • Molecular dynamics simulations of membrane-embedded COII

    • Machine learning for predicting functional consequences of variants

    • Systems biology modeling of respiratory chain function

These technologies promise to provide unprecedented insights into the structure, function, and evolutionary significance of COII in forest pest species .

How can comparison between different Choristoneura species inform evolutionary adaptation research?

Comparative analysis of COII across Choristoneura species offers valuable insights into molecular adaptation:

  • Sequence-based studies can identify sites under positive selection

  • Functional assays can determine the physiological consequences of species-specific substitutions

  • Correlation with ecological data can reveal molecular adaptations to different host plants or climates

  • Investigation of cypoviruses across different Choristoneura species can illuminate co-evolutionary dynamics

The high sequence similarity between C. occidentalis and C. rosaceana COII (>98%) provides a valuable framework for identifying key residues that might be involved in adaptation to different ecological niches, as these species occupy different but overlapping habitats and host ranges .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.